Citrus Sinensis ID: 014098

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVSLGMSRRSSNSGSGSVEIPEFLRQRPHIYHPRA
cccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHccccEEEEEEEEcHHHHHHccccccccEEEcccccccccccccccHHHHHHHHHcHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEEEccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccHHcccccccccccc
cccEEcccccccccccccccEccEEEEEEEEccccccEEEEccccccccEEEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHccccccEEEEEEcEcEHHHHccccccEEEEccHHHHccEcccccHHHHHHHHHHcHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEEccHHHcHHHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHcccEEEEEEEEEEEcccHHHHHHHHHHccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHccccccccc
matristcfapshtcisketqisrasSVKILdyrsdswgacprnVKDFLRLKCsakahnvspnhskdpfldlhpevsmlsgdgtnvLFGSmkeglgksVSESLRqssvpnnnneaKIKVIgvggggsnAVNRMIESSMTGVEFWIVNTDaqamkvspvipenrlqigcdltrglgaggnpsvgmnaanESKVAIEEAISGADMIFVtagmgggtgtgaAPVIAGIAKSMGILTVGIatvpfcfeGRRRAIQAQEGVANLRNnvdtliipglvnvdfADVRAIMKDAgsslmgigtatgKSRARDAALNAIQSPLLDIGIETATGIVwnitggtdltlfEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATgfkgdklegkgthlshndvslgmsrrssnsgsgsveipeflrqrphiyhpra
matristcfapshtcisketqisrassvKILDYRSDSWGACPRNVKDFLRLKCSAKahnvspnhskdpfLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLrqssvpnnnneakikvigvggggsNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLshndvslgmsrrssnsgsgsveipeflrqrphiyhpra
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAkikvigvggggSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFvtagmgggtgtgaapviagiaKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVslgmsrrssnsgsgsVEIPEFLRQRPHIYHPRA
*******CFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSA*************************************************************IKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAG*************KVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATG***ARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGD***********************************************
*****************************************************************************************************************EAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATG***************************************************
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVSL*************VEIPEFLRQRPHIYHPRA
**TRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSG*****************************NNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKG******************************VEI***LRQR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVSLGMSRRSSNSGSGSVEIPEFLRQRPHIYHPRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query430 2.2.26 [Sep-21-2011]
O82533478 Cell division protein Fts yes no 0.979 0.880 0.602 1e-140
Q9LXJ0473 Cell division protein Fts no no 0.860 0.782 0.630 1e-131
P45482428 Cell division protein Fts yes no 0.646 0.649 0.565 4e-75
P73456430 Cell division protein Fts N/A no 0.681 0.681 0.494 2e-74
Q9K9T7382 Cell division protein Fts yes no 0.613 0.691 0.529 1e-70
P45501407 Cell division protein Fts yes no 0.588 0.621 0.498 7e-68
P45500399 Cell division protein Fts yes no 0.588 0.634 0.498 1e-67
P17865382 Cell division protein Fts yes no 0.672 0.756 0.454 5e-67
Q42545433 Cell division protein Fts no no 0.672 0.667 0.492 3e-66
P45499416 Cell division protein Fts yes no 0.583 0.603 0.491 3e-65
>sp|O82533|FTZ21_ARATH Cell division protein FtsZ homolog 2-1, chloroplastic OS=Arabidopsis thaliana GN=FTSZ2-1 PE=1 SV=2 Back     alignment and function desciption
 Score =  497 bits (1279), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 292/485 (60%), Positives = 344/485 (70%), Gaps = 64/485 (13%)

Query: 1   MATRISTCFAPSH----TCISK----ETQISRASSVKILDYRSDSWGACPRNVKDFLRLK 52
           MAT +S CF PS     T + K    E  + R +S++ +D + +      +        K
Sbjct: 1   MATYVSPCFTPSDSRLLTVLRKNVLPENHLGRLNSIRTIDSKKNRVVVAAQ--------K 52

Query: 53  CSAKAHNVSPNH----SKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSV 108
             +     SP H    ++DPFL+LHPE+SML G+GT+ +    KE     V E   + S 
Sbjct: 53  SESSPIRNSPRHYQSQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVVEDFEEPSA 112

Query: 109 PNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGC 168
           P+N NEA+IKVIGVGGGGSNAVNRMIES M+GVEFWIVNTD QAM++SPV+P+NRLQIG 
Sbjct: 113 PSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGK 172

Query: 169 DLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKS 228
           +LTRGLGAGGNP +GMNAA ESK  IEEA+ G+DM+FVTAGMGGGTGTGAAPVIAGIAK+
Sbjct: 173 ELTRGLGAGGNPEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKA 232

Query: 229 MGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLI--------------------- 267
           MGILTVGIAT PF FEGRRR +QAQEG+A+LR+NVDTLI                     
Sbjct: 233 MGILTVGIATTPFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAF 292

Query: 268 -------------------IPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALN 308
                              IPGLVNVDFADVRAIM +AGSSLMGIGTATGKSRARDAALN
Sbjct: 293 NLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALN 352

Query: 309 AIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLS 368
           AIQSPLLDIGIE ATGIVWNITGG+DLTLFEVN AAEVIYDLVDP+ANLIFGAV+D +LS
Sbjct: 353 AIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALS 412

Query: 369 NQVSITLIATGFK-GDKLEGKGTHLSHND-VSLGMSRRSSNS--GSGSVEIPEFLRQRPH 424
            QVSITLIATGFK  ++ EG+   +   D  S+G +RR S+S   SGSVEIPEFL+++  
Sbjct: 413 GQVSITLIATGFKRQEEGEGRTVQMVQADAASVGATRRPSSSFRESGSVEIPEFLKKKGS 472

Query: 425 IYHPR 429
             +PR
Sbjct: 473 SRYPR 477
Exhibits GTPase activity. Component of the plastid division machinery that forms a contractile ring at the division site. Required for plastid division in a dose-dependent manner.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LXJ0|FTZ22_ARATH Cell division protein FtsZ homolog 2-2, chloroplastic OS=Arabidopsis thaliana GN=FTSZ2-2 PE=1 SV=1 Back     alignment and function description
>sp|P45482|FTSZ_NOSS1 Cell division protein FtsZ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsZ PE=3 SV=2 Back     alignment and function description
>sp|P73456|FTSZ_SYNY3 Cell division protein FtsZ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsZ PE=1 SV=1 Back     alignment and function description
>sp|Q9K9T7|FTSZ_BACHD Cell division protein FtsZ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ftsZ PE=3 SV=1 Back     alignment and function description
>sp|P45501|FTSZ_STRGR Cell division protein FtsZ OS=Streptomyces griseus GN=ftsZ PE=3 SV=1 Back     alignment and function description
>sp|P45500|FTSZ_STRCO Cell division protein FtsZ OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ftsZ PE=3 SV=1 Back     alignment and function description
>sp|P17865|FTSZ_BACSU Cell division protein FtsZ OS=Bacillus subtilis (strain 168) GN=ftsZ PE=1 SV=3 Back     alignment and function description
>sp|Q42545|FTSZ1_ARATH Cell division protein FtsZ homolog 1, chloroplastic OS=Arabidopsis thaliana GN=FTSZ1 PE=1 SV=2 Back     alignment and function description
>sp|P45499|FTSZ_KOCRD Cell division protein FtsZ OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ftsZ PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
224132386476 predicted protein [Populus trichocarpa] 0.995 0.899 0.651 1e-153
224102827477 predicted protein [Populus trichocarpa] 0.997 0.899 0.659 1e-151
225440898486 PREDICTED: cell division protein ftsZ ho 1.0 0.884 0.637 1e-146
255575683485 Cell division protein ftsZ, putative [Ri 0.960 0.851 0.654 1e-142
6685070483 FtsZ protein [Gentiana lutea] 1.0 0.890 0.629 1e-142
255565619491 Cell division protein ftsZ, putative [Ri 0.967 0.847 0.639 1e-140
297827101479 hypothetical protein ARALYDRAFT_902736 [ 0.990 0.889 0.600 1e-139
18404086478 Tubulin/FtsZ-like protein [Arabidopsis t 0.979 0.880 0.602 1e-138
377644000484 FtsZ3 protein [Manihot esculenta] 0.881 0.783 0.674 1e-136
356537097 903 PREDICTED: cell division protein ftsZ ho 0.955 0.455 0.622 1e-136
>gi|224132386|ref|XP_002328256.1| predicted protein [Populus trichocarpa] gi|222837771|gb|EEE76136.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 353/476 (74%), Gaps = 48/476 (10%)

Query: 1   MATRISTCFAPSHTCIS------KETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCS 54
           MA+ +S  F PS T IS       E +  R  + +  D +  SWGAC RN     +++CS
Sbjct: 1   MASCVSPPFTPSGTQISVGRRISTENRFGRIVTAQRFDKKKGSWGACGRNAVSISQIRCS 60

Query: 55  AKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNE 114
             +HN+SPNH KD FLDLHPEVSML  D  +      KE  G++V+ES   +S  +N NE
Sbjct: 61  VNSHNISPNH-KDSFLDLHPEVSMLRSDANDTYSSVRKETSGRNVTESSGDTSFMSNYNE 119

Query: 115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGL 174
           AKIKV+GVGGGGSNAVNRMIESS+TGVEFWIVNTD QAMK+SPV+PENRLQ+G +LTRGL
Sbjct: 120 AKIKVVGVGGGGSNAVNRMIESSLTGVEFWIVNTDIQAMKMSPVLPENRLQVGKELTRGL 179

Query: 175 GAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTV 234
           GAGGNP +GMNAANESK AIEEA+ GADM+F+TAGMGGGTGTG APVIAG+AKSMGILTV
Sbjct: 180 GAGGNPDIGMNAANESKAAIEEALYGADMVFITAGMGGGTGTGGAPVIAGVAKSMGILTV 239

Query: 235 GIATVPFCFEGRRRAIQAQEGVANLRNNVDTLI--------------------------- 267
           GI T PF FEGRRRA+QAQEG+A LRNNVDTLI                           
Sbjct: 240 GIVTSPFSFEGRRRAVQAQEGIAALRNNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDI 299

Query: 268 -------------IPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPL 314
                        +PGLVNVDFADVRAIMKDAGSSL+GIGTATGK+RARDAALNAIQSPL
Sbjct: 300 LRQGVRGISDIIMVPGLVNVDFADVRAIMKDAGSSLLGIGTATGKTRARDAALNAIQSPL 359

Query: 315 LDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSIT 374
           LDIGIE ATGIVWNITGGTDLTLFEVN AAEVIYDLVDP+ANLIFGAVID +LS QVSIT
Sbjct: 360 LDIGIERATGIVWNITGGTDLTLFEVNAAAEVIYDLVDPTANLIFGAVIDPALSGQVSIT 419

Query: 375 LIATGF-KGDKLEGKGTHLSHNDVSLGMSRRSSNSGSGSVEIPEFLRQRPHIYHPR 429
           LIATGF + D+ EG+GT  +H DVSLG +RR   +  GSVEIPEFLR++     PR
Sbjct: 420 LIATGFNRRDEGEGQGTQRAHGDVSLGTNRRPPYADGGSVEIPEFLRKKGRSLFPR 475

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102827|ref|XP_002312816.1| predicted protein [Populus trichocarpa] gi|222849224|gb|EEE86771.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225440898|ref|XP_002282740.1| PREDICTED: cell division protein ftsZ homolog 2-1, chloroplastic [Vitis vinifera] gi|147856408|emb|CAN80330.1| hypothetical protein VITISV_018274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575683|ref|XP_002528741.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223531835|gb|EEF33653.1| Cell division protein ftsZ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|6685070|gb|AAF23771.1|AF205859_1 FtsZ protein [Gentiana lutea] Back     alignment and taxonomy information
>gi|255565619|ref|XP_002523799.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223536887|gb|EEF38525.1| Cell division protein ftsZ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297827101|ref|XP_002881433.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. lyrata] gi|297327272|gb|EFH57692.1| hypothetical protein ARALYDRAFT_902736 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18404086|ref|NP_565839.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|42571077|ref|NP_973612.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|75220266|sp|O82533.2|FTZ21_ARATH RecName: Full=Cell division protein FtsZ homolog 2-1, chloroplastic; Short=AtFtsZ2-1; AltName: Full=Plastid division protein FTSZ2-1; Flags: Precursor gi|14195704|gb|AAC35987.2| plastid division protein FtsZ [Arabidopsis thaliana] gi|15292821|gb|AAK92779.1| putative plastid division protein FtsZ [Arabidopsis thaliana] gi|15636809|dbj|BAB68127.1| chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] gi|20197938|gb|AAD21440.2| plastid division protein (FtsZ) [Arabidopsis thaliana] gi|20259559|gb|AAM14122.1| putative plastid division FtsZ protein [Arabidopsis thaliana] gi|330254127|gb|AEC09221.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] gi|330254128|gb|AEC09222.1| Tubulin/FtsZ-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|377644000|gb|AFB70893.1| FtsZ3 protein [Manihot esculenta] Back     alignment and taxonomy information
>gi|356537097|ref|XP_003537067.1| PREDICTED: cell division protein ftsZ homolog 2-1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
TAIR|locus:2049455478 FTSZ2-1 [Arabidopsis thaliana 0.604 0.543 0.489 1.2e-117
TAIR|locus:2083258473 FTSZ2-2 [Arabidopsis thaliana 0.486 0.441 0.541 3e-110
UNIPROTKB|P73456430 ftsZ "Cell division protein Ft 0.281 0.281 0.669 1.1e-72
TIGR_CMR|CHY_2060352 CHY_2060 "cell division protei 0.358 0.437 0.484 2.6e-67
TAIR|locus:2161610433 FTSZ1-1 "homolog of bacterial 0.272 0.270 0.538 3.7e-66
TIGR_CMR|BA_4045386 BA_4045 "cell division protein 0.367 0.409 0.484 2.9e-64
UNIPROTKB|P17865382 ftsZ "Cell division protein Ft 0.367 0.413 0.472 4.8e-64
TIGR_CMR|DET_0636376 DET_0636 "cell division protei 0.404 0.462 0.425 1.1e-60
TIGR_CMR|DET_0343376 DET_0343 "cell division protei 0.272 0.311 0.572 7.8e-60
TIGR_CMR|SPO_1204 542 SPO_1204 "cell division protei 0.269 0.214 0.495 3.3e-52
TAIR|locus:2049455 FTSZ2-1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 1.2e-117, Sum P(2) = 1.2e-117
 Identities = 137/280 (48%), Positives = 174/280 (62%)

Query:     1 MATRISTCFAPSH----TCISK----ETQISRASSVKILDYRSDSWGACPRNVKDFLRLK 52
             MAT +S CF PS     T + K    E  + R +S++ +D + +      +  +      
Sbjct:     1 MATYVSPCFTPSDSRLLTVLRKNVLPENHLGRLNSIRTIDSKKNRVVVAAQKSE------ 54

Query:    53 CSAKAHNVSPNH----SKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSV 108
              S+   N SP H    ++DPFL+LHPE+SML G+GT+ +    KE     V E   + S 
Sbjct:    55 -SSPIRN-SPRHYQSQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVVEDFEEPSA 112

Query:   109 PNNNNEAXXXXXXXXXXXSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGC 168
             P+N NEA           SNAVNRMIES M+GVEFWIVNTD QAM++SPV+P+NRLQIG 
Sbjct:   113 PSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGK 172

Query:   169 DLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFXXXXXXXXXXXXXXXXXXXXXKS 228
             +LTRGLGAGGNP +GMNAA ESK  IEEA+ G+DM+F                     K+
Sbjct:   173 ELTRGLGAGGNPEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKA 232

Query:   229 MGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLII 268
             MGILTVGIAT PF FEGRRR +QAQEG+A+LR+NVDTLI+
Sbjct:   233 MGILTVGIATTPFSFEGRRRTVQAQEGLASLRDNVDTLIV 272
GO:0003924 "GTPase activity" evidence=IEA;IDA
GO:0005198 "structural molecule activity" evidence=ISS
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0043234 "protein complex" evidence=IEA
GO:0051258 "protein polymerization" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0043621 "protein self-association" evidence=IDA
GO:0010020 "chloroplast fission" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
TAIR|locus:2083258 FTSZ2-2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P73456 ftsZ "Cell division protein FtsZ" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2060 CHY_2060 "cell division protein FtsZ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:2161610 FTSZ1-1 "homolog of bacterial cytokinesis Z-ring protein FTSZ 1-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4045 BA_4045 "cell division protein FtsZ" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P17865 ftsZ "Cell division protein FtsZ" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0636 DET_0636 "cell division protein FtsZ" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0343 DET_0343 "cell division protein FtsZ" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1204 SPO_1204 "cell division protein FtsZ" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P45482FTSZ_NOSS1No assigned EC number0.56570.64650.6495yesno
P94337FTSZ_CORGLNo assigned EC number0.51290.62320.6063yesno
Q9K9T7FTSZ_BACHDNo assigned EC number0.52940.61390.6910yesno
O82533FTZ21_ARATHNo assigned EC number0.60200.97900.8807yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
PRK09330384 PRK09330, PRK09330, cell division protein FtsZ; Va 1e-152
cd02201304 cd02201, FtsZ_type1, FtsZ is a GTPase that is simi 1e-136
PRK13018378 PRK13018, PRK13018, cell division protein FtsZ; Pr 1e-117
TIGR00065349 TIGR00065, ftsZ, cell division protein FtsZ 1e-114
COG0206338 COG0206, FtsZ, Cell division GTPase [Cell division 1e-107
cd02191303 cd02191, FtsZ, FtsZ is a GTPase that is similar to 6e-74
smart00864192 smart00864, Tubulin, Tubulin/FtsZ family, GTPase d 1e-61
smart00865120 smart00865, Tubulin_C, Tubulin/FtsZ family, C-term 1e-37
pfam00091210 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase do 4e-36
pfam1232795 pfam12327, FtsZ_C, FtsZ family, C-terminal domain 2e-35
cd02202349 cd02202, FtsZ_type2, FtsZ is a GTPase that is simi 1e-16
cd00286328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ 4e-10
>gnl|CDD|236468 PRK09330, PRK09330, cell division protein FtsZ; Validated Back     alignment and domain information 
 Score =  437 bits (1126), Expect = e-152
 Identities = 170/376 (45%), Positives = 219/376 (58%), Gaps = 65/376 (17%)

Query: 110 NNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCD 169
             N  A IKVIGVGGGG NAVNRMIE  + GVEF   NTDAQA+  S      ++Q+G  
Sbjct: 9   EENQGAVIKVIGVGGGGGNAVNRMIEEGIQGVEFIAANTDAQALLKSKA--PVKIQLGEK 66

Query: 170 LTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSM 229
           LTRGLGAG NP VG  AA ES+  I EA+ GADM+F+TAGMGGGTGTGAAPV+A IAK +
Sbjct: 67  LTRGLGAGANPEVGRKAAEESREEIREALEGADMVFITAGMGGGTGTGAAPVVAEIAKEL 126

Query: 230 GILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLII--------------------- 268
           GILTV + T PF FEG++R  QA+EG+  LR +VDTLI+                     
Sbjct: 127 GILTVAVVTKPFSFEGKKRMKQAEEGIEELRKHVDTLIVIPNDKLLEVVDKKTPLLDAFK 186

Query: 269 -------------------PGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNA 309
                              PGL+N+DFADV+ +M + G ++MGIG A+G+ RAR+AA  A
Sbjct: 187 AADDVLRQAVQGITDLITKPGLINLDFADVKTVMSEMGLAMMGIGEASGEDRAREAAEKA 246

Query: 310 IQSPLLD-IGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLS 368
           I SPLL+ + I  A G++ NITGG DLTLFEV  AAE+I +  DP AN+IFG VID+ L 
Sbjct: 247 ISSPLLEDVDISGAKGVLVNITGGPDLTLFEVEEAAEIIREAADPDANIIFGTVIDEELG 306

Query: 369 NQVSITLIATGFKGDKL----------------EGKGTHLSHNDVSLGMSRRSSNSGSGS 412
           +++ +T+IATGF    +                                +  S+   + S
Sbjct: 307 DEIRVTVIATGFGRQAVVPEKQEQQPVETRTDEAPVAPLPQEPQAVAEPAEASAAVEAQS 366

Query: 413 ------VEIPEFLRQR 422
                 ++IP FLR++
Sbjct: 367 EKDEDDLDIPAFLRRQ 382

Length = 384
>gnl|CDD|100021 cd02201, FtsZ_type1, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|237273 PRK13018, PRK13018, cell division protein FtsZ; Provisional Back     alignment and domain information
>gnl|CDD|232805 TIGR00065, ftsZ, cell division protein FtsZ Back     alignment and domain information
>gnl|CDD|223284 COG0206, FtsZ, Cell division GTPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|100020 cd02191, FtsZ, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|214867 smart00864, Tubulin, Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>gnl|CDD|214868 smart00865, Tubulin_C, Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|215710 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>gnl|CDD|204882 pfam12327, FtsZ_C, FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|100022 cd02202, FtsZ_type2, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
PRK09330384 cell division protein FtsZ; Validated 100.0
PRK13018378 cell division protein FtsZ; Provisional 100.0
COG0206338 FtsZ Cell division GTPase [Cell division and chrom 100.0
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 100.0
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the 100.0
cd02191303 FtsZ FtsZ is a GTPase that is similar to the eukar 100.0
cd02202349 FtsZ_type2 FtsZ is a GTPase that is similar to the 100.0
cd00286328 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin 99.96
smart00864192 Tubulin Tubulin/FtsZ family, GTPase domain. This d 99.95
PF1232795 FtsZ_C: FtsZ family, C-terminal domain; InterPro: 99.95
PF00091216 Tubulin: Tubulin/FtsZ family, GTPase domain; Inter 99.93
cd06059382 Tubulin The tubulin superfamily includes five dist 99.78
smart00865120 Tubulin_C Tubulin/FtsZ family, C-terminal domain. 99.63
cd02190379 epsilon_tubulin The tubulin superfamily includes f 99.54
PTZ00387 465 epsilon tubulin; Provisional 99.29
cd02188431 gamma_tubulin Gamma-tubulin is a ubiquitous phylog 99.15
PLN00222454 tubulin gamma chain; Provisional 99.14
cd02189446 delta_tubulin The tubulin superfamily includes fiv 99.14
cd02186434 alpha_tubulin The tubulin superfamily includes fiv 99.13
cd02187425 beta_tubulin The tubulin superfamily includes five 99.12
PF13809345 Tubulin_2: Tubulin like 99.05
PLN00220447 tubulin beta chain; Provisional 99.03
PTZ00335448 tubulin alpha chain; Provisional 98.93
PTZ00010445 tubulin beta chain; Provisional 98.7
PLN00221450 tubulin alpha chain; Provisional 98.6
COG5023443 Tubulin [Cytoskeleton] 97.81
KOG1374448 consensus Gamma tubulin [Cytoskeleton] 97.38
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.62
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.27
CHL00194317 ycf39 Ycf39; Provisional 95.14
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.83
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.66
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.23
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.11
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 93.88
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 93.86
PTZ00082321 L-lactate dehydrogenase; Provisional 93.8
PRK06153393 hypothetical protein; Provisional 93.76
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.7
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.69
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.53
cd06060 493 misato Human Misato shows similarity with Tubulin/ 93.32
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.31
PRK05086312 malate dehydrogenase; Provisional 93.31
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.9
PRK08328231 hypothetical protein; Provisional 92.6
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.53
PRK06223307 malate dehydrogenase; Reviewed 92.52
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 92.37
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 92.36
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 92.25
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 92.23
PTZ00117319 malate dehydrogenase; Provisional 91.95
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.71
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 91.68
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.36
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 91.28
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 91.11
PRK08223287 hypothetical protein; Validated 90.85
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 90.74
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 90.73
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 90.7
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.6
PRK09496 453 trkA potassium transporter peripheral membrane com 90.52
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 90.5
PLN02427386 UDP-apiose/xylose synthase 90.3
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.21
PRK10886196 DnaA initiator-associating protein DiaA; Provision 90.15
PLN00106323 malate dehydrogenase 90.12
PRK12549284 shikimate 5-dehydrogenase; Reviewed 90.09
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 89.91
PRK05442326 malate dehydrogenase; Provisional 89.88
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 89.5
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 89.44
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 89.39
PTZ00325321 malate dehydrogenase; Provisional 89.24
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 89.15
KOG2013 603 consensus SMT3/SUMO-activating complex, catalytic 88.8
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 88.57
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 88.45
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 88.42
PRK00048257 dihydrodipicolinate reductase; Provisional 87.93
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 87.91
PLN02602350 lactate dehydrogenase 87.52
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 87.46
PRK05865 854 hypothetical protein; Provisional 87.2
PRK15076 431 alpha-galactosidase; Provisional 87.11
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 86.91
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 86.75
PRK14852 989 hypothetical protein; Provisional 86.49
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 86.37
KOG2015422 consensus NEDD8-activating complex, catalytic comp 86.37
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 86.35
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 86.2
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 86.1
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 85.93
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 85.88
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.79
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 85.75
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 85.72
PRK13302271 putative L-aspartate dehydrogenase; Provisional 85.64
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 85.4
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 84.95
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 84.92
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 84.84
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 84.62
PLN02688266 pyrroline-5-carboxylate reductase 84.23
PLN02735 1102 carbamoyl-phosphate synthase 84.16
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 83.95
COG2403449 Predicted GTPase [General function prediction only 83.52
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 83.26
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 83.23
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 82.83
PLN03209 576 translocon at the inner envelope of chloroplast su 82.83
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 82.76
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 82.71
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 82.59
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 82.58
TIGR00441154 gmhA phosphoheptose isomerase. Involved in lipopol 82.5
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 82.42
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 82.41
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 81.91
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 81.63
PLN00112444 malate dehydrogenase (NADP); Provisional 81.61
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 81.5
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 81.22
PRK07411390 hypothetical protein; Validated 81.19
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 81.17
PRK13936197 phosphoheptose isomerase; Provisional 81.16
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 81.14
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 80.98
TIGR01081 448 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl 80.93
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 80.86
PRK06545359 prephenate dehydrogenase; Validated 80.21
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information 
Probab=100.00  E-value=2.6e-80  Score=632.12  Aligned_cols=267  Identities=61%  Similarity=0.977  Sum_probs=261.4

Q ss_pred             CCCCeEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHhhhcCCCCCCceEEcCCccCCCCCCCCCchHHHHHHHHhH
Q 014098          112 NNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESK  191 (430)
Q Consensus       112 ~~~~kIkVIGVGGaG~NiV~~m~~~~~~gve~iaiNTD~q~L~~s~~~a~~ki~iG~~~t~GlGaG~dP~vG~~aA~e~~  191 (430)
                      .+.++|+||||||||||+||+|++.++++++||++|||.|+|..++  +++||+||+++|+|+|||+||++|++||+++.
T Consensus        11 ~~~~~IkViGvGG~G~Nav~~m~~~~~~~v~fia~NTD~q~L~~~~--a~~ki~lG~~~t~GlGaG~~pe~G~~aaee~~   88 (384)
T PRK09330         11 NQGAVIKVIGVGGGGGNAVNRMIEEGIQGVEFIAANTDAQALLKSK--APVKIQLGEKLTRGLGAGANPEVGRKAAEESR   88 (384)
T ss_pred             ccCCeEEEEEECCcHHHHHHHHHHcCCCCceEEEEeCcHHHHhcCC--CCeEEEcCCcccccCCCCCCHHHHHHHHHHHH
Confidence            4467999999999999999999999999999999999999999987  48999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCEEEEEccCCCCCCCCcHHHHHHHHHHcCCcEEEEEeccCCchhHHHHHHHHHHHHHHHHhhcccc----
Q 014098          192 VAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLI----  267 (430)
Q Consensus       192 e~I~~~L~gaD~VfI~AGLGGGTGTGaaPvIA~~AKe~giltVaIVTlPF~fEG~~r~~~A~~gL~~L~~~vD~lI----  267 (430)
                      ++|+++|+++|+|||+||||||||||++|+||++||++|++||+|||+||.|||++|+.+|.++|++|++++|++|    
T Consensus        89 e~I~~~l~~~D~vfI~AGmGGGTGTGaapvIA~iake~g~ltvaVvt~PF~fEG~~r~~nA~~gL~~L~~~~D~vIvi~N  168 (384)
T PRK09330         89 EEIREALEGADMVFITAGMGGGTGTGAAPVVAEIAKELGILTVAVVTKPFSFEGKKRMKQAEEGIEELRKHVDTLIVIPN  168 (384)
T ss_pred             HHHHHHHcCCCEEEEEecCCCcccHHHHHHHHHHHHHcCCcEEEEEecCccccchhHHHHHHHHHHHHHHHCCEEEEEec
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998    


Q ss_pred             ------------------------------------cCccccccHHHHHHHHhhcCeeEEEEEEecCCchHHHHHHHHHh
Q 014098          268 ------------------------------------IPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQ  311 (430)
Q Consensus       268 ------------------------------------~pglINvDfaDvk~Il~~~G~A~mGiG~a~G~~ra~~Av~~AL~  311 (430)
                                                          .||+||+||+||+++|+++|.|+||+|+++|++|+.+|+++||+
T Consensus       169 d~L~~~~~~~~~l~~Af~~ad~vL~~~v~~It~~i~~pG~iNvDfaDvk~vm~~~G~a~~G~G~a~g~~ra~~A~~~Ai~  248 (384)
T PRK09330        169 DKLLEVVDKKTPLLDAFKAADDVLRQAVQGITDLITKPGLINLDFADVKTVMSEMGLAMMGIGEASGEDRAREAAEKAIS  248 (384)
T ss_pred             HHHHhhccCCCCHHHHHHHHHHHHHHHHHHHHHHHhcCCcccCCHHHHHHHHhcCCeEEEEEEEecCccHHHHHHHHHHh
Confidence                                                58999999999999999999999999999999999999999999


Q ss_pred             CCCCc-CCccccCceEEEEEeCCCCCHHHHHHHHHHHHhhcCCCccEEEeeeeCCCCCCeEEEEEEeecC
Q 014098          312 SPLLD-IGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGF  380 (430)
Q Consensus       312 sPLLd-~~i~~A~gvLvnI~gg~dl~L~Ev~~a~~~I~~~~~~~a~Ii~G~~ide~l~d~vrVTvIATGf  380 (430)
                      ||||+ .++++|+++||||+++++|+|.|++++++.|++.++++++||||+++||+|+++++||||||||
T Consensus       249 spLl~~~~i~~A~~vLv~I~g~~~l~l~e~~~~~~~i~~~~~~~a~Ii~G~~~d~~l~~~i~VtviatG~  318 (384)
T PRK09330        249 SPLLEDVDISGAKGVLVNITGGPDLTLFEVEEAAEIIREAADPDANIIFGTVIDEELGDEIRVTVIATGF  318 (384)
T ss_pred             CcCcCCCChhhcceEEEEEECCCCCCHHHHHHHHHHHHHHhCCCCeEEEeeeeCCCcCCeEEEEEEEccC
Confidence            99997 7899999999999999999999999999999999999999999999999999999999999999

>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>COG0206 FtsZ Cell division GTPase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>cd02191 FtsZ FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>cd02202 FtsZ_type2 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>smart00864 Tubulin Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>PF12327 FtsZ_C: FtsZ family, C-terminal domain; InterPro: IPR024757 The FtsZ family of proteins are involved in polymer formation Back     alignment and domain information
>PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>smart00865 Tubulin_C Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PTZ00387 epsilon tubulin; Provisional Back     alignment and domain information
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>PLN00222 tubulin gamma chain; Provisional Back     alignment and domain information
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PF13809 Tubulin_2: Tubulin like Back     alignment and domain information
>PLN00220 tubulin beta chain; Provisional Back     alignment and domain information
>PTZ00335 tubulin alpha chain; Provisional Back     alignment and domain information
>PTZ00010 tubulin beta chain; Provisional Back     alignment and domain information
>PLN00221 tubulin alpha chain; Provisional Back     alignment and domain information
>COG5023 Tubulin [Cytoskeleton] Back     alignment and domain information
>KOG1374 consensus Gamma tubulin [Cytoskeleton] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd06060 misato Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>TIGR00441 gmhA phosphoheptose isomerase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
2vam_A382 Ftsz B. Subtilis Length = 382 8e-63
2rhh_A325 Synthetic Gene Encoded Bacillus Subtilis Ftsz With 2e-62
1rlu_A382 Mycobacterium Tuberculosis Ftsz In Complex With Gtp 1e-60
2q1x_A379 Crystal Structure Of Cell Division Protein Ftsz Fro 1e-60
4e6e_A314 Crystal Structure Of A Putative Cell Division Prote 8e-58
4dxd_A396 Staphylococcal Aureus Ftsz In Complex With 723 Leng 9e-58
3vo8_A392 Staphylococcus Aureus Ftsz Gdp-Form Length = 392 1e-57
3voa_A308 Staphylococcus Aureus Ftsz 12-316 Gdp-Form Length = 3e-57
3vo9_A308 Staphylococcus Aureus Ftsz Apo-Form (Semet) Length 1e-51
2vaw_A394 Ftsz Pseudomonas Aeruginosa Gdp Length = 394 4e-46
1ofu_A320 Crystal Structure Of Sula:ftsz From Pseudomonas Aer 2e-45
1w5f_A353 Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Leng 3e-41
1w5e_A364 Ftsz W319y Mutant, P1 (m. Jannaschii) Length = 364 1e-39
1fsz_A372 Crystal Structure Of The Cell-Division Protein Ftsz 4e-39
1w58_1364 Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 4e-39
2r6r_1338 Aquifex Aeolicus Ftsz Length = 338 6e-38
>pdb|2VAM|A Chain A, Ftsz B. Subtilis Length = 382 Back     alignment and structure 
Iteration: 1

 Score =  237 bits (605), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 173/289 (59%), Gaps = 42/289 (14%)
Query: 132 RMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESK 191
           RMIE+ + GVE+  VNTDAQA+ +S    E ++QIG  LTRGLGAG NP VG  AA ESK
Sbjct: 29  RMIENEVQGVEYIAVNTDAQALNLSKA--EVKMQIGAKLTRGLGAGANPEVGKKAAEESK 86
Query: 192 VAIEEAISGADMIFXXXXXXXXXXXXXXXXXXXXXKSMGILTVGIATVPFCFEGRRRAIQ 251
             IEEA+ GADM+F                     K +G LTVG+ T PF FEGR+R +Q
Sbjct: 87  EQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQ 146
Query: 252 AQEGVANLRNNVDTLII----------------------------------------PGL 271
           A  G++ ++  VDTLI+                                        PGL
Sbjct: 147 AAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGL 206
Query: 272 VNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITG 331
           +N+DFADV+ IM + GS+LMGIG ATG++RA +AA  AI SPLL+  I+ A G++ NITG
Sbjct: 207 INLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITG 266
Query: 332 GTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGF 380
           GT+L+L+EV  AA+++    D   N+IFG+VI+++L +++ +T+IATGF
Sbjct: 267 GTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGF 315
>pdb|2RHH|A Chain A, Synthetic Gene Encoded Bacillus Subtilis Ftsz With Bound Sulfate Ion Length = 325 Back     alignment and structure
>pdb|1RLU|A Chain A, Mycobacterium Tuberculosis Ftsz In Complex With Gtp-Gamma-S Length = 382 Back     alignment and structure
>pdb|2Q1X|A Chain A, Crystal Structure Of Cell Division Protein Ftsz From Mycobacterium Tuberculosis In Complex With Citrate. Length = 379 Back     alignment and structure
>pdb|4E6E|A Chain A, Crystal Structure Of A Putative Cell Division Protein Ftsz (Tfu_1113) From Thermobifida Fusca Yx-Er1 At 2.22 A Resolution Length = 314 Back     alignment and structure
>pdb|4DXD|A Chain A, Staphylococcal Aureus Ftsz In Complex With 723 Length = 396 Back     alignment and structure
>pdb|3VO8|A Chain A, Staphylococcus Aureus Ftsz Gdp-Form Length = 392 Back     alignment and structure
>pdb|3VOA|A Chain A, Staphylococcus Aureus Ftsz 12-316 Gdp-Form Length = 308 Back     alignment and structure
>pdb|3VO9|A Chain A, Staphylococcus Aureus Ftsz Apo-Form (Semet) Length = 308 Back     alignment and structure
>pdb|2VAW|A Chain A, Ftsz Pseudomonas Aeruginosa Gdp Length = 394 Back     alignment and structure
>pdb|1OFU|A Chain A, Crystal Structure Of Sula:ftsz From Pseudomonas Aeruginosa Length = 320 Back     alignment and structure
>pdb|1W5F|A Chain A, Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Length = 353 Back     alignment and structure
>pdb|1W5E|A Chain A, Ftsz W319y Mutant, P1 (m. Jannaschii) Length = 364 Back     alignment and structure
>pdb|1FSZ|A Chain A, Crystal Structure Of The Cell-Division Protein Ftsz At 2.8a Resolution Length = 372 Back     alignment and structure
>pdb|1W58|1 Chain 1, Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 Back     alignment and structure
>pdb|2R6R|1 Chain 1, Aquifex Aeolicus Ftsz Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
2vxy_A382 FTSZ, cell division protein FTSZ; GTP-binding, nuc 1e-162
1rq2_A382 Cell division protein FTSZ; cell cycle, tubulin, G 1e-161
4dxd_A396 Cell division protein FTSZ; rossmann fold, GTPase, 1e-160
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polyme 1e-158
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP 1e-154
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, 1e-154
2vaw_A394 FTSZ, cell division protein FTSZ; bacterial cell d 1e-151
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell d 1e-150
4ei7_A389 Plasmid replication protein REPX; GTP hydrolase, p 5e-71
3v3t_A360 Cell division GTPase FTSZ, diverged; TUBZ, tubulin 2e-56
3m89_A427 FTSZ/tubulin-related protein; partition, TUBZ, GTP 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3r4v_A315 Putative uncharacterized protein; tubulin, unknown 4e-09
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Length = 382 Back     alignment and structure
 Score =  460 bits (1187), Expect = e-162
 Identities = 173/374 (46%), Positives = 230/374 (61%), Gaps = 63/374 (16%)

Query: 110 NNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCD 169
           N +  A IKVIGVGGGG+NAVNRMIE+ + GVE+  VNTDAQA+ +S    E ++QIG  
Sbjct: 7   NIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKA--EVKMQIGAK 64

Query: 170 LTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSM 229
           LTRGLGAG NP VG  AA ESK  IEEA+ GADM+FVTAGMGGGTGTGAAPVIA IAK +
Sbjct: 65  LTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDL 124

Query: 230 GILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLII--------------------- 268
           G LTVG+ T PF FEGR+R +QA  G++ ++  VDTLI+                     
Sbjct: 125 GALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFR 184

Query: 269 -------------------PGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNA 309
                              PGL+N+DFADV+ IM + GS+LMGIG ATG++RA +AA  A
Sbjct: 185 EADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKA 244

Query: 310 IQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSN 369
           I SPLL+  I+ A G++ NITGGT+L+L+EV  AA+++    D   N+IFG+VI+++L +
Sbjct: 245 ISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKD 304

Query: 370 QVSITLIATGFKGDKLEGKGTHLSHNDVSLG---------------------MSRRSSNS 408
           ++ +T+IATGF   + +         + S+                      +SR +S  
Sbjct: 305 EIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKRDAKREEPQQQNTVSRHTSQP 364

Query: 409 GSGSVEIPEFLRQR 422
              +++IP FLR R
Sbjct: 365 ADDTLDIPTFLRNR 378
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Length = 382 Back     alignment and structure
>4dxd_A Cell division protein FTSZ; rossmann fold, GTPase, GTP binding, cell cycle-inhibitor COM; HET: GDP 9PC; 2.01A {Staphylococcus aureus} Length = 396 Back     alignment and structure
>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Length = 364 Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Length = 353 Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Length = 338 Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 394 Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 320 Back     alignment and structure
>4ei7_A Plasmid replication protein REPX; GTP hydrolase, plasmid segregation; HET: GDP; 1.90A {Bacillus cereus} PDB: 4ei8_A 4ei9_A* Length = 389 Back     alignment and structure
>3v3t_A Cell division GTPase FTSZ, diverged; TUBZ, tubulin/FTSZ related, rossmann fold, GTP bindi structural protein; 2.30A {Clostridium botulinum C} Length = 360 Back     alignment and structure
>3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A 2xka_A* 2xkb_A* Length = 427 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A* Length = 315 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
4dxd_A396 Cell division protein FTSZ; rossmann fold, GTPase, 100.0
2vxy_A382 FTSZ, cell division protein FTSZ; GTP-binding, nuc 100.0
2vaw_A394 FTSZ, cell division protein FTSZ; bacterial cell d 100.0
1rq2_A382 Cell division protein FTSZ; cell cycle, tubulin, G 100.0
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell d 100.0
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP 100.0
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polyme 100.0
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, 100.0
4ei7_A389 Plasmid replication protein REPX; GTP hydrolase, p 100.0
3v3t_A360 Cell division GTPase FTSZ, diverged; TUBZ, tubulin 100.0
3m89_A427 FTSZ/tubulin-related protein; partition, TUBZ, GTP 100.0
3r4v_A315 Putative uncharacterized protein; tubulin, unknown 100.0
2btq_B426 Tubulin btubb; structural protein, cytoskeletal pr 99.92
2bto_A473 Tubulin btuba; bacterial tubulin, polymerization, 99.9
3cb2_A475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 99.79
3ryc_B445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 99.45
3ryc_A451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 99.33
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 96.96
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.86
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.78
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.59
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.98
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.98
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.67
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.66
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.38
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.25
3slg_A372 PBGP3 protein; structural genomics, seattle struct 95.2
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 95.2
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.17
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.94
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.89
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.75
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 94.71
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.67
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.6
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.49
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.28
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 94.02
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.96
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.93
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 93.88
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 93.69
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 93.68
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.67
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.61
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.56
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.47
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.46
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.46
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 93.34
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 93.33
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 93.07
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.05
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 92.91
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.81
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.8
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 92.79
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.66
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 92.64
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 92.55
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 92.5
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 92.44
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 92.35
1id1_A153 Putative potassium channel protein; RCK domain, E. 92.35
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 92.29
1xq6_A253 Unknown protein; structural genomics, protein stru 92.2
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 92.18
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 92.04
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 91.99
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 91.96
3ius_A286 Uncharacterized conserved protein; APC63810, silic 91.88
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 91.81
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.76
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.62
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 91.62
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 91.58
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 91.55
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 91.52
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 91.45
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 91.3
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 91.08
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 91.03
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 90.99
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 90.77
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 90.73
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 90.68
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 90.66
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.65
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 90.59
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.54
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 90.31
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 90.05
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 89.94
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.82
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 89.76
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 89.67
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.48
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 89.33
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 89.2
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 89.14
4g65_A 461 TRK system potassium uptake protein TRKA; structur 89.12
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 89.12
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 89.11
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 88.97
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 88.97
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 88.89
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 88.81
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 88.7
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 88.59
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 88.53
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 88.44
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 87.94
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 87.86
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 87.74
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.68
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 87.61
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 87.57
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 87.51
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 87.08
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 87.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 86.47
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 86.27
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 86.07
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 85.89
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 85.88
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 85.61
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 85.57
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 85.51
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 85.4
3tl2_A315 Malate dehydrogenase; center for structural genomi 85.19
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 85.15
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 85.1
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 85.09
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 85.08
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 84.87
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 84.71
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 84.52
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 84.43
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 84.38
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 84.23
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 84.18
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 84.12
3euw_A344 MYO-inositol dehydrogenase; protein structure init 83.88
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 83.77
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 83.48
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 83.31
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 83.31
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 83.2
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 82.92
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 82.86
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 82.6
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 82.46
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 82.25
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 81.99
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 81.83
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 81.24
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 81.21
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 81.15
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 81.1
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 81.08
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 81.07
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 80.86
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 80.72
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 80.43
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 80.38
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 80.32
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 80.31
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 80.05
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 80.05
>4dxd_A Cell division protein FTSZ; rossmann fold, GTPase, GTP binding, cell cycle-inhibitor COM; HET: GDP 9PC; 2.01A {Staphylococcus aureus} PDB: 3vo8_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-78  Score=616.80  Aligned_cols=270  Identities=57%  Similarity=0.930  Sum_probs=262.5

Q ss_pred             CCCCeEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHhhhcCCCCCCceEEcCCccCCCCCCCCCchHHHHHHHHhH
Q 014098          112 NNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESK  191 (430)
Q Consensus       112 ~~~~kIkVIGVGGaG~NiV~~m~~~~~~gve~iaiNTD~q~L~~s~~~a~~ki~iG~~~t~GlGaG~dP~vG~~aA~e~~  191 (430)
                      ...++|+||||||||||+||+|++.++++|+||++|||.|+|..++  +++||+||+++|+|+|||+||++|+++|+++.
T Consensus        15 ~~~~~IkVIGVGG~G~NaVn~m~~~~~~gvefiaiNTD~qaL~~s~--a~~ki~lG~~~t~GlGAG~np~vG~eaaee~~   92 (396)
T 4dxd_A           15 NHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSK--AESKIQIGEKLTRGLGAGANPEIGKKAAEESR   92 (396)
T ss_dssp             ---CCEEEEEEHHHHHHHHHHHHHHCCCSEEEEEEESCHHHHHTCC--CSEEEECCHHHHTTSCCTTCHHHHHHHHHHTH
T ss_pred             CCCCeEEEEEECCcHHHHHHHHHHhCCCCceEEEEECCHHHHhcCC--CccEEEcCccccCCCCCCCChHHHHHHHHHHH
Confidence            4568999999999999999999999999999999999999999986  48999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCEEEEEccCCCCCCCCcHHHHHHHHHHcCCcEEEEEeccCCchhHHHHHHHHHHHHHHHHhhcccc----
Q 014098          192 VAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLI----  267 (430)
Q Consensus       192 e~I~~~L~gaD~VfI~AGLGGGTGTGaaPvIA~~AKe~giltVaIVTlPF~fEG~~r~~~A~~gL~~L~~~vD~lI----  267 (430)
                      ++|++++++||++||++|||||||||++|+|++++|++|++||+|||.||.|||.+|..||..+|++|++++|++|    
T Consensus        93 d~Ir~~le~~D~ffItagmGGGTGSGaapvIaeiake~g~LtvsVVt~Pf~~Eg~~r~yNA~lgl~~L~e~vD~vIvIdN  172 (396)
T 4dxd_A           93 EQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPN  172 (396)
T ss_dssp             HHHHHHHTTCSEEEEEEETTSSHHHHHHHHHHHHHHHTTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHHSSEEEEEEG
T ss_pred             HHHHHHHcCCCEEEEEeccCCCccccHHHHHHHHHHhcCCceEEEEeCCccccchHHHHHHHHHHHHHHhhCCEEEEEcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998    


Q ss_pred             ------------------------------------cCccccccHHHHHHHHhhcCeeEEEEEEecCCchHHHHHHHHHh
Q 014098          268 ------------------------------------IPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQ  311 (430)
Q Consensus       268 ------------------------------------~pglINvDfaDvk~Il~~~G~A~mGiG~a~G~~ra~~Av~~AL~  311 (430)
                                                          .||++|+||+||+++|++.|.|+||+|+++|++|+.+|+++||+
T Consensus       173 eaL~~I~~~~l~i~~af~~aN~ll~q~VsgIT~~irfpG~iNvDfaDv~t~m~~~G~A~mG~G~a~G~~ra~~A~~~Ai~  252 (396)
T 4dxd_A          173 DRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAIS  252 (396)
T ss_dssp             GGGGGTCCTTCCHHHHHHHHHHHHHHHHHHHHHHHHSCCTBCCCHHHHHHHHTTCEECEEEEEEEESTTHHHHHHHHHHC
T ss_pred             HHHHHhhcccccHHHHHHHHHHHHHHHHHhhhhhhccCCcccCCHHHHHHHhhcCCeEEEEEEeccCCchHHHHHHHHHh
Confidence                                                58999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCccccCceEEEEEeCCCCCHHHHHHHHHHHHhhcCCCccEEEeeeeCCCCCCeEEEEEEeecCCCC
Q 014098          312 SPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGD  383 (430)
Q Consensus       312 sPLLd~~i~~A~gvLvnI~gg~dl~L~Ev~~a~~~I~~~~~~~a~Ii~G~~ide~l~d~vrVTvIATGf~~~  383 (430)
                      ||||+.+|++|+++||||+|+++++|.|++++++.|++.++++++||||+++||+|+++|+||||||||+.+
T Consensus       253 sPLL~~~i~gAkgvLvnItgg~dl~l~Ev~~~~~~i~~~~~~~a~ii~G~~~d~~l~~~i~VtviaTG~~~~  324 (396)
T 4dxd_A          253 SPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDK  324 (396)
T ss_dssp             CSSCSSCSTTCCEEEEEEEECTTCCHHHHHHHHHHHHHHHSSCCEEEEEEEECTTSTTEEEEEEEEECCCCC
T ss_pred             CccccCChhhhcceEEEEEcCCCCCHHHHHHHHHHHHHHcCCCCeEEEeeeeCCCCCCcEEEEEEEecCCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999866
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Back     alignment and structure
>4ei7_A Plasmid replication protein REPX; GTP hydrolase, plasmid segregation; HET: GDP; 1.90A {Bacillus cereus} PDB: 4ei8_A 4ei9_A* Back     alignment and structure
>3v3t_A Cell division GTPase FTSZ, diverged; TUBZ, tubulin/FTSZ related, rossmann fold, GTP bindi structural protein; 2.30A {Clostridium botulinum C} Back     alignment and structure
>3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A 2xka_A* 2xkb_A* Back     alignment and structure
>3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A* Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... Back     alignment and structure
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 430
d1ofua1198 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Ps 2e-56
d1rq2a1198 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Myc 5e-52
d2vapa1209 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Ar 3e-48
d1w5fa1194 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Th 9e-46
d1w5fa2121 d.79.2.1 (A:216-336) Cell-division protein FtsZ {T 2e-34
d1rq2a2107 d.79.2.1 (A:206-312) Cell-division protein FtsZ {M 2e-32
d2vapa2123 d.79.2.1 (A:232-354) Cell-division protein FtsZ {A 3e-30
d1ofua2109 d.79.2.1 (A:209-317) Cell-division protein FtsZ {P 5e-30
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Length = 198 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tubulin nucleotide-binding domain-like
superfamily: Tubulin nucleotide-binding domain-like
family: Tubulin, GTPase domain
domain: Cell-division protein FtsZ
species: Pseudomonas aeruginosa [TaxId: 287]

 Score =  182 bits (464), Expect = 2e-56
 Identities = 89/154 (57%), Positives = 108/154 (70%), Gaps = 2/154 (1%)

Query: 115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGL 174
           A IKVIGVGGGG NAVN M ++++ GVEF   NTDAQA+K         LQ+G  +T+GL
Sbjct: 2   AVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAA--RTVLQLGPGVTKGL 59

Query: 175 GAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTV 234
           GAG NP VG  AA E +  I E + GADM+F+T GMGGGTGTGAAP+IA +AK MGILTV
Sbjct: 60  GAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTV 119

Query: 235 GIATVPFCFEGRRRAIQAQEGVANLRNNVDTLII 268
            + T PF FEGR+R   A EG+  L  +VD+LI 
Sbjct: 120 AVVTRPFPFEGRKRMQIADEGIRALAESVDSLIT 153
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 209 Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Length = 194 Back     information, alignment and structure
>d1w5fa2 d.79.2.1 (A:216-336) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d1rq2a2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Length = 107 Back     information, alignment and structure
>d2vapa2 d.79.2.1 (A:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 123 Back     information, alignment and structure
>d1ofua2 d.79.2.1 (A:209-317) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 100.0
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 100.0
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 100.0
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 100.0
d2vapa2123 Cell-division protein FtsZ {Archaeon Methanococcus 100.0
d1w5fa2121 Cell-division protein FtsZ {Thermotoga maritima [T 100.0
d1rq2a2107 Cell-division protein FtsZ {Mycobacterium tubercul 100.0
d1ofua2109 Cell-division protein FtsZ {Pseudomonas aeruginosa 99.97
d2btoa1244 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 98.78
d1tubb1243 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 98.68
d1tuba1245 Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 98.53
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.71
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.66
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.25
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.17
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.81
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.76
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.63
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.45
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.79
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.77
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 94.61
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.57
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.57
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.42
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.27
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.23
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.19
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.14
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.44
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 93.27
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.26
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 93.15
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.91
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.67
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.5
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.43
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 92.18
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 91.94
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.89
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.58
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.51
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.04
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.99
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.08
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 89.69
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 88.82
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 88.8
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 88.76
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 88.56
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.29
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 88.14
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.77
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 87.5
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 87.43
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 86.68
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 85.31
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 84.43
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 84.29
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 83.88
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 83.81
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 83.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 83.09
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 82.67
d1x94a_191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T 81.29
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tubulin nucleotide-binding domain-like
superfamily: Tubulin nucleotide-binding domain-like
family: Tubulin, GTPase domain
domain: Cell-division protein FtsZ
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=2.7e-50  Score=376.04  Aligned_cols=151  Identities=61%  Similarity=0.981  Sum_probs=143.3

Q ss_pred             CeEEEEeeCcchHHHHHHHHHcCCCcceEEEEeCcHHhhhcCCCCCCceEEcCCccCCCCCCCCCchHHHHHHHHhHHHH
Q 014098          115 AKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAI  194 (430)
Q Consensus       115 ~kIkVIGVGGaG~NiV~~m~~~~~~gve~iaiNTD~q~L~~s~~~a~~ki~iG~~~t~GlGaG~dP~vG~~aA~e~~e~I  194 (430)
                      ++||||||||||||++|+|+++++++++||++|||.|+|..+.  +++|+++|++.|+|+|+|+||++|++||+++.++|
T Consensus         2 a~IkViGvGGaG~n~vn~~~~~~~~~v~~iainTD~~~L~~~~--~~~ki~iG~~~t~G~Gagg~p~~g~~aa~e~~~~I   79 (198)
T d1rq2a1           2 AVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSD--ADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEI   79 (198)
T ss_dssp             CCEEEEEEHHHHHHHHHHHHHTTCCSEEEEEEESCHHHHHHCC--CSEEEECCTTTC-----CCCHHHHHHHHHHTHHHH
T ss_pred             CeEEEEEeCchHHHHHHHHHHcCCCCceEEEEcchHHHHhcCC--cchhhccccccccCCCcCcChhhhHhhHHHHHHHH
Confidence            5899999999999999999999999999999999999999986  48999999999999999999999999999999999


Q ss_pred             HHHhcCCCEEEEEccCCCCCCCCcHHHHHHHHHHcCCcEEEEEeccCCchhHHHHHHHHHHHHHHHHhhcccc
Q 014098          195 EEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLI  267 (430)
Q Consensus       195 ~~~L~gaD~VfI~AGLGGGTGTGaaPvIA~~AKe~giltVaIVTlPF~fEG~~r~~~A~~gL~~L~~~vD~lI  267 (430)
                      +++|+++|+|||+||||||||||++|+||++||++|++||+|||+||+|||++|+++|+++|++|++++|++|
T Consensus        80 ~~~l~~~d~vfi~AGlGGgTGtGaaPviA~iake~g~l~v~ivt~PF~~EG~~r~~~A~~gl~~L~~~~D~~I  152 (198)
T d1rq2a1          80 EELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLI  152 (198)
T ss_dssp             HHHHTTCSEEEEEEETTSSHHHHHHHHHHHHHHHHTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHHCSEEE
T ss_pred             HHHhcCCCEEEEEEecCCCCCcchHHHHHHHHHHcCCcEEEEEecChHHHHHHHHHHHHHHHHHHHHhhCeEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999998
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2vapa2 d.79.2.1 (A:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w5fa2 d.79.2.1 (A:216-336) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rq2a2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ofua2 d.79.2.1 (A:209-317) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure