Citrus Sinensis ID: 014105

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATDS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHccccccccccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEcccccccccEEEEcccccccccccccccEEccccccccccccccHHHHHHHHHHHHHccHHHHHccccccccccccEEEccccccEEEccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccccc
ccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccEEEccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHcccccccccccccccccEccEEEcccccHHccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHccHHHHHHHHHHHHHHHHccccccEEccccccccEEEEEccccccEEEEccccEEEEcccccccccccHHHHHHHHHHcccccHcHHHHHHcccccccccccEEcccccccEEEccccccEEEEEEcccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcEEccHHccccccEEccc
mesedefdmqdanasaeeddfysggdddaapayafdsddadvadyefidndsddsddlvsnrhqlnytvlTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLlekpavqfpdgeemtcgicfenypsdrllaaacghpfcsscwtgyistaindgpgclmlrcpdpscgaavgQDMIYLLSSDEDKVKYNRYFIRSYVednrktkwcpapgcdyavdfvvgsgnydvtcrcsysfcwncteeahrpvdcdtVAKWVLKNSAESENMNwilanskpcprckrpieknqgcmhmtctppckfefcwlclgqwsdhgertggfyacnryetakqegvydesEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHvtkrctvptrvtaqvhhrslatds
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDndsddsddlvsnrhqlnytvlteadirqrqEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLlekpavqfpdgeemTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLssdedkvkyNRYFIRsyvednrktkwcpaPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEeahrpvdcdtVAKWVLKnsaesenmnwilanskpcprcKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETakqegvydesekrREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVhvtkrctvptrvtaqvhhrslatds
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIdndsddsddLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATDS
**************************************************************HQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETA*********************RYTHYYERWAT***********L*QMQTVHVTKRCTVPTRVT************
*ESEDEF****************************DSDDADVADYEFIDND***********HQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAV*************EEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWV**********NWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYET*********************ERYTHYYERWATNQSS*****************************VHHRSLAT**
**********************SGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAK**************AKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATDS
*******************************************************D**VSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQ************MAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATD*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query430 2.2.26 [Sep-21-2011]
Q8W468 567 Probable E3 ubiquitin-pro yes no 0.934 0.708 0.754 0.0
Q84RR0 562 Probable E3 ubiquitin-pro no no 0.932 0.713 0.714 1e-180
Q8L829 552 Probable E3 ubiquitin-pro no no 0.888 0.692 0.692 1e-170
P0C8K8 552 Putative E3 ubiquitin-pro no no 0.869 0.677 0.664 1e-158
Q9SKC2 542 Probable E3 ubiquitin-pro no no 0.904 0.717 0.514 1e-122
Q9SKC3 543 Probable E3 ubiquitin-pro no no 0.874 0.692 0.496 1e-120
Q9SKC4 514 Probable E3 ubiquitin-pro no no 0.823 0.688 0.511 1e-115
Q6T486520 Probable E3 ubiquitin-pro yes no 0.874 0.723 0.354 3e-69
Q84RQ9 496 Probable E3 ubiquitin-pro no no 0.741 0.643 0.380 4e-60
Q9P3U4504 Uncharacterized RING fing yes no 0.834 0.712 0.338 9e-58
>sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 Back     alignment and function desciption
 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/404 (75%), Positives = 350/404 (86%), Gaps = 2/404 (0%)

Query: 18  EDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVSNRHQLNYTVLTEADIRQ 77
           +DDFYSG ++ +  A + D DDAD  +YEF+D+ +DDSDDL+  R Q NY+VL+EADI +
Sbjct: 4   DDDFYSGTENYSDYADS-DEDDAD-GEYEFVDDAADDSDDLIFRRRQQNYSVLSEADICK 61

Query: 78  RQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFP 137
            QE+DI+RISTVLSIS+ +++ILLR YNW VS+VHDEWFADEE+VR AVGLLEKP V FP
Sbjct: 62  LQEDDISRISTVLSISRNSSAILLRHYNWCVSRVHDEWFADEEKVRDAVGLLEKPVVDFP 121

Query: 138 DGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAA 197
              E+ CGICFE + SD+L AAACGHPFC SCW GYI+TAINDGPGCL LRCPDPSC AA
Sbjct: 122 TDGELDCGICFETFLSDKLHAAACGHPFCDSCWEGYITTAINDGPGCLTLRCPDPSCRAA 181

Query: 198 VGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRC 257
           VGQDMI LL+ D+DK KY  YF+RSYVEDNRKTKWCPAPGCDYAV+FVVGSGNYDV CRC
Sbjct: 182 VGQDMINLLAPDKDKQKYTSYFVRSYVEDNRKTKWCPAPGCDYAVNFVVGSGNYDVNCRC 241

Query: 258 SYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMH 317
            YSFCWNC EEAHRPVDCDTV+KWVLKNSAESENMNWILANSKPCP+CKRPIEKNQGCMH
Sbjct: 242 CYSFCWNCAEEAHRPVDCDTVSKWVLKNSAESENMNWILANSKPCPKCKRPIEKNQGCMH 301

Query: 318 MTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLER 377
           +TCTPPCKFEFCWLCLG W++HGE+TGGFYACNRYE AKQ+G+YDE+EKRREMAKNSLER
Sbjct: 302 ITCTPPCKFEFCWLCLGAWTEHGEKTGGFYACNRYEAAKQDGIYDETEKRREMAKNSLER 361

Query: 378 YTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQV 421
           YTHYYERWATNQSSRQKAL DL++MQT  + K   +  +  +Q+
Sbjct: 362 YTHYYERWATNQSSRQKALLDLKKMQTDDIEKLSDIQCQPESQL 405
Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 Back     alignment and function description
>sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 Back     alignment and function description
>sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 Back     alignment and function description
>sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 Back     alignment and function description
>sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 Back     alignment and function description
>sp|Q84RQ9|ARI12_ARATH Probable E3 ubiquitin-protein ligase ARI12 OS=Arabidopsis thaliana GN=ARI12 PE=2 SV=2 Back     alignment and function description
>sp|Q9P3U4|YKX2_SCHPO Uncharacterized RING finger protein C328.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.02 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
224109192 591 predicted protein [Populus trichocarpa] 0.967 0.703 0.847 0.0
224101249 591 predicted protein [Populus trichocarpa] 0.967 0.703 0.821 0.0
449442245 597 PREDICTED: probable E3 ubiquitin-protein 0.986 0.710 0.791 0.0
359495753 652 PREDICTED: probable E3 ubiquitin-protein 0.930 0.613 0.833 0.0
298205054 581 unnamed protein product [Vitis vinifera] 0.916 0.678 0.827 0.0
147843035 588 hypothetical protein VITISV_023021 [Viti 0.927 0.678 0.790 0.0
414586613 589 TPA: putative RING zinc finger domain su 0.955 0.697 0.736 0.0
242073556 589 hypothetical protein SORBIDRAFT_06g02108 0.955 0.697 0.738 0.0
326522708 589 predicted protein [Hordeum vulgare subsp 0.955 0.697 0.736 0.0
226506396 589 LOC100273409 [Zea mays] gi|194703960|gb| 0.955 0.697 0.731 0.0
>gi|224109192|ref|XP_002315117.1| predicted protein [Populus trichocarpa] gi|222864157|gb|EEF01288.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/421 (84%), Positives = 388/421 (92%), Gaps = 5/421 (1%)

Query: 1   MESEDEFDMQDANASAEEDDFYSGGDDDAAPAYAFDSDDADVADYEFIDNDSDDSDDLVS 60
           M+SEDEFDMQDA A + EDDFYSGG++D      FDSDDADVADYEFIDNDSDDSDDL+S
Sbjct: 1   MDSEDEFDMQDAAAESAEDDFYSGGEEDG-----FDSDDADVADYEFIDNDSDDSDDLIS 55

Query: 61  NRHQLNYTVLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEE 120
           +RHQ NYTVL+E DIRQRQ++D+ RI+TVLSISKVAASILLR+YNWSVSKVHDEWFADEE
Sbjct: 56  HRHQQNYTVLSEEDIRQRQDDDVMRIATVLSISKVAASILLRYYNWSVSKVHDEWFADEE 115

Query: 121 RVRKAVGLLEKPAVQFPDGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAIND 180
           +VRKAVGLLE+P V FPDG EMTCGICFE YPSDRLLAAACGHPFC+SCW GYISTAIND
Sbjct: 116 KVRKAVGLLEEPVVPFPDGREMTCGICFETYPSDRLLAAACGHPFCNSCWAGYISTAIND 175

Query: 181 GPGCLMLRCPDPSCGAAVGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDY 240
           GPGCLMLRCPDPSC AA+GQDMI LL+SDED  K++RYFIRSY+EDNRKTKWCPAPGCDY
Sbjct: 176 GPGCLMLRCPDPSCNAAIGQDMINLLTSDEDSEKHSRYFIRSYIEDNRKTKWCPAPGCDY 235

Query: 241 AVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSK 300
           AVDF+VGSG+YDVTCRC+YSFCWNCTEEAHRPVDC TVAKW+LKNSAESENMNWILANSK
Sbjct: 236 AVDFIVGSGSYDVTCRCAYSFCWNCTEEAHRPVDCGTVAKWILKNSAESENMNWILANSK 295

Query: 301 PCPRCKRPIEKNQGCMHMTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGV 360
           PCP+CKRPIEKNQGCMH+TCTPPCKFEFC LCLG WSDHGERTGGFYACNRYETAKQEGV
Sbjct: 296 PCPKCKRPIEKNQGCMHITCTPPCKFEFCRLCLGAWSDHGERTGGFYACNRYETAKQEGV 355

Query: 361 YDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQ 420
           YDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQ VH+ K   +  +  +Q
Sbjct: 356 YDESEKRREMAKNSLERYTHYYERWATNQSSRQKALADLQQMQNVHLEKLSDIQCQPESQ 415

Query: 421 V 421
           +
Sbjct: 416 L 416

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101249|ref|XP_002312201.1| predicted protein [Populus trichocarpa] gi|222852021|gb|EEE89568.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449442245|ref|XP_004138892.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359495753|ref|XP_002268068.2| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298205054|emb|CBI38350.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147843035|emb|CAN83309.1| hypothetical protein VITISV_023021 [Vitis vinifera] Back     alignment and taxonomy information
>gi|414586613|tpg|DAA37184.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|242073556|ref|XP_002446714.1| hypothetical protein SORBIDRAFT_06g021080 [Sorghum bicolor] gi|241937897|gb|EES11042.1| hypothetical protein SORBIDRAFT_06g021080 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|326522708|dbj|BAJ88400.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527705|dbj|BAK08127.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|226506396|ref|NP_001141318.1| LOC100273409 [Zea mays] gi|194703960|gb|ACF86064.1| unknown [Zea mays] gi|413918762|gb|AFW58694.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
TAIR|locus:2206315 567 ARI8 "ARIADNE 8" [Arabidopsis 0.934 0.708 0.740 7.7e-174
TAIR|locus:2065954 562 ARI7 "ARIADNE 7" [Arabidopsis 0.932 0.713 0.704 2.8e-169
TAIR|locus:2045188 543 ARI9 "ARIADNE 9" [Arabidopsis 0.881 0.697 0.498 9.4e-114
TAIR|locus:2045223 514 ARI10 "ARIADNE 10" [Arabidopsi 0.846 0.708 0.506 2.6e-111
DICTYBASE|DDB_G0286961520 rbrA "IBR zinc finger-containi 0.897 0.742 0.352 2.1e-70
POMBASE|SPAC328.02504 SPAC328.02 "ubiquitin-protein 0.865 0.738 0.332 6.9e-63
ASPGD|ASPL0000014787511 AN3689 [Emericella nidulans (t 0.860 0.724 0.353 3e-62
UNIPROTKB|G4NDZ4 522 MGG_00859 "Ariadne-1" [Magnapo 0.862 0.710 0.344 3e-62
MGI|MGI:1344363555 Arih1 "ariadne ubiquitin-conju 0.758 0.587 0.355 1.1e-58
UNIPROTKB|A2VEA3555 ARIH1 "E3 ubiquitin-protein li 0.758 0.587 0.355 1.8e-58
TAIR|locus:2206315 ARI8 "ARIADNE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1689 (599.6 bits), Expect = 7.7e-174, P = 7.7e-174
 Identities = 299/404 (74%), Positives = 342/404 (84%)

Query:    18 EDDFYSGGDDDAAPAYAFDSDDADVADYEFIXXXXXXXXXLVSNRHQLNYTVLTEADIRQ 77
             +DDFYSG ++ +  A + D DDAD  +YEF+         L+  R Q NY+VL+EADI +
Sbjct:     4 DDDFYSGTENYSDYADS-DEDDAD-GEYEFVDDAADDSDDLIFRRRQQNYSVLSEADICK 61

Query:    78 RQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFP 137
              QE+DI+RISTVLSIS+ +++ILLR YNW VS+VHDEWFADEE+VR AVGLLEKP V FP
Sbjct:    62 LQEDDISRISTVLSISRNSSAILLRHYNWCVSRVHDEWFADEEKVRDAVGLLEKPVVDFP 121

Query:   138 DGEEMTCGICFENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAA 197
                E+ CGICFE + SD+L AAACGHPFC SCW GYI+TAINDGPGCL LRCPDPSC AA
Sbjct:   122 TDGELDCGICFETFLSDKLHAAACGHPFCDSCWEGYITTAINDGPGCLTLRCPDPSCRAA 181

Query:   198 VGQDMIYLLSSDEDKVKYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTCRC 257
             VGQDMI LL+ D+DK KY  YF+RSYVEDNRKTKWCPAPGCDYAV+FVVGSGNYDV CRC
Sbjct:   182 VGQDMINLLAPDKDKQKYTSYFVRSYVEDNRKTKWCPAPGCDYAVNFVVGSGNYDVNCRC 241

Query:   258 SYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKRPIEKNQGCMH 317
              YSFCWNC EEAHRPVDCDTV+KWVLKNSAESENMNWILANSKPCP+CKRPIEKNQGCMH
Sbjct:   242 CYSFCWNCAEEAHRPVDCDTVSKWVLKNSAESENMNWILANSKPCPKCKRPIEKNQGCMH 301

Query:   318 MTCTPPCKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLER 377
             +TCTPPCKFEFCWLCLG W++HGE+TGGFYACNRYE AKQ+G+YDE+EKRREMAKNSLER
Sbjct:   302 ITCTPPCKFEFCWLCLGAWTEHGEKTGGFYACNRYEAAKQDGIYDETEKRREMAKNSLER 361

Query:   378 YTHYYERWATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQV 421
             YTHYYERWATNQSSRQKAL DL++MQT  + K   +  +  +Q+
Sbjct:   362 YTHYYERWATNQSSRQKALLDLKKMQTDDIEKLSDIQCQPESQL 405
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2065954 ARI7 "ARIADNE 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045188 ARI9 "ARIADNE 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045223 ARI10 "ARIADNE 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286961 rbrA "IBR zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC328.02 SPAC328.02 "ubiquitin-protein ligase involved in sporulation" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000014787 AN3689 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NDZ4 MGG_00859 "Ariadne-1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:1344363 Arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A2VEA3 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W468ARI8_ARATH6, ., 3, ., 2, ., -0.75490.93480.7089yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
smart0064764 smart00647, IBR, In Between Ring fingers 3e-19
pfam0148563 pfam01485, IBR, IBR domain 5e-13
pfam0148563 pfam01485, IBR, IBR domain 2e-05
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information 
 Score = 80.9 bits (200), Expect = 3e-19
 Identities = 29/63 (46%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 214 KYNRYFIRSYVEDNRKTKWCPAPGCDYAVDFVVGSGNYDVTC-RCSYSFCWNCTEEAHRP 272
           KY R  + SYVE N   KWCPAP C  A+      G   VTC +C +SFC+ C    H P
Sbjct: 2   KYERLLLESYVESNPDLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPWHSP 61

Query: 273 VDC 275
           V C
Sbjct: 62  VSC 64

the domains occurs between pairs og RING fingers. Length = 64
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
KOG1815444 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.93
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.34
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.73
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.43
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.39
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.37
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.36
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.31
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.3
smart0064764 IBR In Between Ring fingers. the domains occurs be 98.26
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 98.2
PF1463444 zf-RING_5: zinc-RING finger domain 98.08
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.06
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.03
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.92
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.82
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.76
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
PHA02929238 N1R/p28-like protein; Provisional 97.73
PHA02926242 zinc finger-like protein; Provisional 97.71
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.69
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.48
KOG4367 699 consensus Predicted Zn-finger protein [Function un 97.32
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.26
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.04
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.84
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.83
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 96.78
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.77
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.72
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 96.63
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.61
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.53
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.45
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.34
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.2
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.83
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.71
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.37
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.36
COG5152259 Uncharacterized conserved protein, contains RING a 95.17
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.02
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
KOG2660331 consensus Locus-specific chromosome binding protei 94.52
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 94.06
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 93.78
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 93.75
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 93.65
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 93.64
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 93.63
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 93.01
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 92.27
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 91.92
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 91.92
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 91.02
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 90.99
smart0066152 RPOL9 RNA polymerase subunit 9. 90.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.38
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 90.27
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.06
KOG4739233 consensus Uncharacterized protein involved in syna 90.02
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 89.92
PF1324023 zinc_ribbon_2: zinc-ribbon domain 89.84
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 89.67
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 89.44
PF1324826 zf-ribbon_3: zinc-ribbon domain 88.8
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 88.76
PHA0062659 hypothetical protein 88.44
PRK14559 645 putative protein serine/threonine phosphatase; Pro 88.38
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 88.26
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 87.86
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 87.25
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 87.16
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 87.15
KOG0297391 consensus TNF receptor-associated factor [Signal t 87.06
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 86.99
KOG2807378 consensus RNA polymerase II transcription initiati 86.85
KOG1001674 consensus Helicase-like transcription factor HLTF/ 86.52
PRK0043250 30S ribosomal protein S27ae; Validated 85.41
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 85.1
PHA03096284 p28-like protein; Provisional 84.68
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 84.63
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 84.4
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 84.33
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.05
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 83.89
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 83.52
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 83.19
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 81.96
KOG1941518 consensus Acetylcholine receptor-associated protei 81.61
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 81.57
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 81.35
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 81.17
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 80.68
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 80.55
PF1371937 zinc_ribbon_5: zinc-ribbon domain 80.36
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 80.17
COG5222427 Uncharacterized conserved protein, contains RING Z 80.13
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-57  Score=460.32  Aligned_cols=344  Identities=47%  Similarity=0.907  Sum_probs=316.2

Q ss_pred             EecHHHHHHHHHHHHHHHHhHcCCCHHHHHHHHHhcCCChhhhhhhhhhcHHHHHHHhCCCCCCCcCCCCCCcccccccc
Q 014105           69 VLTEADIRQRQEEDITRISTVLSISKVAASILLRFYNWSVSKVHDEWFADEERVRKAVGLLEKPAVQFPDGEEMTCGICF  148 (430)
Q Consensus        69 ~l~~~~i~~~~~~~i~~v~~~l~i~~~~a~~LL~~~~W~~~~l~~~~~~~~~~~~~~~gl~~~~~~~~~~~~~~~C~IC~  148 (430)
                      +|+.++|...|.+.|..|+++|++++..|++||.+|.|+..++++.|+.+++.++..+|+...+    ......+|.||+
T Consensus         2 vl~~~~~~~~~~~~i~~~~~~ls~~~~~~~~ll~~~~W~~~kl~~~~~~~~~~~~~~~g~~~~~----~~~~~~~c~ic~   77 (444)
T KOG1815|consen    2 VLTPDDIAALMREDIIEVSDILSLSHAVARILLAHFCWNVEKLLEEWVEDEETGCFFVGLLLWP----KKKGDVQCGICV   77 (444)
T ss_pred             CCchHhhhHHhHhhHHHHHHhhcCCHHHHHHHHHhcCcchHHHHHHHHhcCcchhhhccccccC----CCCccccCCccc
Confidence            6889999999999999999999999999999999999999999999999999999999987654    345578999999


Q ss_pred             ccccCCCeeeccCCCcccHHHHHHHHHhhhcCCCceeecccCCCCCCCCchhhHHHhhcCh-HHHHHHHHHHHHHHHhcC
Q 014105          149 ENYPSDRLLAAACGHPFCSSCWTGYISTAINDGPGCLMLRCPDPSCGAAVGQDMIYLLSSD-EDKVKYNRYFIRSYVEDN  227 (430)
Q Consensus       149 e~~~~~~~~~l~CgH~fC~~Cl~~yi~~~i~~g~~~~~i~CP~~~C~~~l~~~~i~~ll~~-e~~~ky~~~~~~~~v~~~  227 (430)
                      +.++. .+..+.|||.||..||..|+..+|..+.... |+||...|.+.+..+.|..++++ +...+|.++++++|++.+
T Consensus        78 ~~~~~-~~~~~~c~H~~c~~cw~~yl~~kI~~~~~~~-i~cp~~~C~a~v~~~~i~~~~s~~~~~~ky~~~i~~syve~~  155 (444)
T KOG1815|consen   78 ESYDG-EIIGLGCGHPFCPPCWTGYLGTKIHEGEEAK-IKCPAHGCPALVGEDTVEKLVSDKEDKEKYQRYILRSYVEDN  155 (444)
T ss_pred             CCCcc-hhhhcCCCcHHHHHHHHHHhhheeecccccc-ccCCCCCccccCCCceeeeecCCHHHHHHHHHHHHHHHHhcC
Confidence            98865 6788899999999999999999999986433 99999999999999999999988 499999999999999999


Q ss_pred             CCceecCCCCCCceEEeecCCCCceEEecCCCccccccCCcCCCCCCchhHHHHHHhhhhhHHHHHHHHhcCCCCCCCCc
Q 014105          228 RKTKWCPAPGCDYAVDFVVGSGNYDVTCRCSYSFCWNCTEEAHRPVDCDTVAKWVLKNSAESENMNWILANSKPCPRCKR  307 (430)
Q Consensus       228 ~~~~~CP~p~C~~~i~~~~~~~~~~v~C~C~~~fC~~C~~~~H~~~~C~~~~~~~~~~~~e~~~~~~i~~~tk~CP~C~~  307 (430)
                      ..++|||+|+|+.++.+. ......|.|.|++.|||.|+.+||.|.+|.....|+.+...++++.+||.+|+++||+|.+
T Consensus       156 ~~lkwCP~~~C~~av~~~-~~~~~~v~C~~g~~FC~~C~~~~H~p~~C~~~~~wl~k~~~~se~~~wi~~ntk~CP~c~~  234 (444)
T KOG1815|consen  156 VPLKWCPAPGCGLAVKFG-SLESVEVDCGCGHEFCFACGEESHSPVSCPGAKKWLKKCRDDSETINWILANTKECPKCKV  234 (444)
T ss_pred             CccccCCCCCCCceeecc-CCCccceeCCCCchhHhhccccccCCCcccchHHHHHhhhhhhhhhhhhhccCccCCCccc
Confidence            999999999999999875 4456889999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeecCCCCceEecCC--CccccccccccccccCCCCCCCcccCCchhhhhccCCCcHHHHHHHHHHhhhhhhhhHHHHH
Q 014105          308 PIEKNQGCMHMTCTPP--CKFEFCWLCLGQWSDHGERTGGFYACNRYETAKQEGVYDESEKRREMAKNSLERYTHYYERW  385 (430)
Q Consensus       308 ~IeK~~GCnhm~C~~~--C~~~FCw~C~~~~~~h~~~~g~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~l~ry~~y~~r~  385 (430)
                      +|||++|||||+|. .  |++.|||+|++.|.+|+..+  +|.|++|...+..      . .+++++..|.||.|||.||
T Consensus       235 ~iek~~gc~~~~~~-~~~c~~~FCw~Cl~~~~~h~~~~--~~~c~~~~~~~~~------~-~~~~a~~~l~r~~~~~~~~  304 (444)
T KOG1815|consen  235 PIEKDGGCNHMTCK-SASCKHEFCWVCLASLSDHGSST--GYSCNRYVDGKSK------S-ARSKARRSLKRYTHYYNRW  304 (444)
T ss_pred             chhccCCccccccc-cCCcCCeeceeeecccccccccc--eeeeeeeechhhh------h-HHHHHHHHHHHHHHHHhhH
Confidence            99999999999998 6  99999999999999999755  8999999876431      1 5788999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHhhhcCCCCCCCceeEeecccC
Q 014105          386 ATNQSSRQKALADLQQMQTVHVTKRCTVPTRVTAQVHHRSLATD  429 (430)
Q Consensus       386 ~~~~~s~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  429 (430)
                      ++|+.|++++...+..+......++.....++..++.++.++.+
T Consensus       305 ~~~q~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  348 (444)
T KOG1815|consen  305 MEHQVSLKLEGKLLSKVEEVKKPKLSDSLSLSWIDVQFLRDAGD  348 (444)
T ss_pred             HhhhhhhhhhhhhHHHHHHHhhhhhhcccCeeeeeeeeechhHH
Confidence            99999999999999999999999999998899999999988753

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
1wd2_A60 Solution Structure Of The C-Terminal Ring From A Ri 1e-11
>pdb|1WD2|A Chain A, Solution Structure Of The C-Terminal Ring From A Ring-Ibr- Ring (Triad) Motif Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 4/60 (6%)
Query: 294 WILANSKPCPRCKRPIEKNQGCMHMTC-TPPCKFEFCWLCLGQWSDHGERTGGFYACNRY 352
           WI AN+K CP+C   IEK+ GC HM C    CK EFCW+CLG W  HG     +Y CNRY
Sbjct: 1   WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGS---AWYNCNRY 57

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 1e-26
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-17
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 1e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 7e-04
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 7e-04
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 Back     alignment and structure
 Score =  100 bits (251), Expect = 1e-26
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 4/61 (6%)

Query: 294 WILANSKPCPRCKRPIEKNQGCMHMTCTPP-CKFEFCWLCLGQWSDHGERTGGFYACNRY 352
           WI AN+K CP+C   IEK+ GC HM C    CK EFCW+CLG W  HG     +Y CNRY
Sbjct: 1   WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGS---AWYNCNRY 57

Query: 353 E 353
            
Sbjct: 58  N 58
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.84
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.65
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.37
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.2
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.16
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.78
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.65
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.65
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.64
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.64
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.64
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.62
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.6
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.58
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.55
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.55
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.55
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.53
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.52
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.51
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.51
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.51
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.5
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.49
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.47
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.46
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.45
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.44
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.43
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.42
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.42
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.41
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.4
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.39
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.39
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.38
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.33
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.32
2ect_A78 Ring finger protein 126; metal binding protein, st 98.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.26
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.25
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.21
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.21
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.2
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.19
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.17
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.16
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.14
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.11
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.1
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.99
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.91
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.87
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.85
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.78
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.71
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.69
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 97.63
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.61
2ea5_A68 Cell growth regulator with ring finger domain prot 97.58
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.56
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.55
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.52
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.51
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 96.94
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.94
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.93
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.54
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.18
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.67
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 95.49
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 95.05
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 94.69
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.46
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 93.86
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.62
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 93.2
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 92.49
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 92.2
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 91.03
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 90.31
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 90.09
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 89.75
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 88.52
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 88.33
3nw0_A238 Non-structural maintenance of chromosomes element 88.03
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 87.79
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 86.48
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 85.94
2di0_A71 Activating signal cointegrator 1 complex subunit 2 85.9
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 84.9
2ysj_A63 Tripartite motif-containing protein 31; ring-type 84.53
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 84.33
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 84.24
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 84.15
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 83.44
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 82.69
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 82.36
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 81.96
2ysl_A73 Tripartite motif-containing protein 31; ring-type 81.95
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 81.78
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 81.34
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 81.18
2ecw_A85 Tripartite motif-containing protein 30; metal bind 81.13
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 80.73
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 80.63
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 80.07
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.84  E-value=9.8e-23  Score=148.20  Aligned_cols=57  Identities=58%  Similarity=1.443  Sum_probs=53.1

Q ss_pred             HHHhcCCCCCCCCcceeecCCCCceEecCC--CccccccccccccccCCCCCCCcccCCchhh
Q 014105          294 WILANSKPCPRCKRPIEKNQGCMHMTCTPP--CKFEFCWLCLGQWSDHGERTGGFYACNRYET  354 (430)
Q Consensus       294 ~i~~~tk~CP~C~~~IeK~~GCnhm~C~~~--C~~~FCw~C~~~~~~h~~~~g~~~~C~~~~~  354 (430)
                      ||++++|+||+|+++|||++|||||+|+ .  |+++|||+|+++|+.|+.   .+|.||+|++
T Consensus         1 wi~~~~k~CP~C~~~Iek~~GCnhmtC~-~~~C~~~FCw~C~~~~~~~~~---~~y~C~~y~~   59 (60)
T 1wd2_A            1 WIAANTKECPKCHVTIEKDGGCNHMVCR-NQNCKAEFCWVCLGPWEPHGS---AWYNCNRYNE   59 (60)
T ss_dssp             CCCCCCCCCTTTCCCCSSCCSCCSSSCC-SSGGGSCCSSSSCSCSGGGGT---SSSSSCSCCC
T ss_pred             CccccceECcCCCCeeEeCCCCCcEEEC-CCCcCCEEeeCcCCCcccCCC---ccccCCCccc
Confidence            6788999999999999999999999998 7  999999999999999985   6899999963
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 430
d1wd2a_60 g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho 2e-22
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 3e-15
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 1e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-12
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 87.6 bits (217), Expect = 2e-22
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 4/61 (6%)

Query: 294 WILANSKPCPRCKRPIEKNQGCMHMTCTPP-CKFEFCWLCLGQWSDHGERTGGFYACNRY 352
           WI AN+K CP+C   IEK+ GC HM C    CK EFCW+CLG W  HG     +Y CNRY
Sbjct: 1   WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHG---SAWYNCNRY 57

Query: 353 E 353
            
Sbjct: 58  N 58
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.83
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.58
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.14
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.12
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.66
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.59
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.53
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.41
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.4
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.35
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.3
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.27
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.21
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.2
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.17
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.16
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.59
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.44
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.43
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 95.87
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 95.52
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 93.95
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 92.99
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 91.06
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 90.3
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 90.21
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 88.69
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 87.7
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 85.97
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 84.98
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 83.12
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 80.82
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.83  E-value=1.2e-22  Score=145.82  Aligned_cols=58  Identities=57%  Similarity=1.417  Sum_probs=52.6

Q ss_pred             HHHhcCCCCCCCCcceeecCCCCceEec-CCCccccccccccccccCCCCCCCcccCCchhh
Q 014105          294 WILANSKPCPRCKRPIEKNQGCMHMTCT-PPCKFEFCWLCLGQWSDHGERTGGFYACNRYET  354 (430)
Q Consensus       294 ~i~~~tk~CP~C~~~IeK~~GCnhm~C~-~~C~~~FCw~C~~~~~~h~~~~g~~~~C~~~~~  354 (430)
                      ||..|||+||+|+++|||++|||||+|+ +.|+++|||+|+++|..|+.   ++|.|++|++
T Consensus         1 wi~~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~---~~~~C~~~~e   59 (60)
T d1wd2a_           1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGS---AWYNCNRYNE   59 (60)
T ss_dssp             CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGT---SSSSSCSCCC
T ss_pred             CchhcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCC---CCCCCcCCcc
Confidence            6788999999999999999999999996 14999999999999999875   7899999964
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure