Citrus Sinensis ID: 014150


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MKXREPPKFPCKLETELDRLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPHLVFDNHCVSTSSQDQTFIKNKLVNIVDHVLLLHNGPILKFKLSHRDLLGVSDIDRWILYMSRSCVKEFILEIWKGQRYKVPSSLFLCQNLIHLELFNCLLKPPSTFKGFRNLKSLDLQHITLSQDVFENLISSSPTLERLTLMNFDGFTHLNIDAPNLQFFDIGGVFDDVTFENTFHLALVSIGLYVNVKNDQAMGPGNSCKLLRFFVHLPHIRRLEIQSYFLKYLAIGNVPSRLPRPCVDLNYLSIRINFNDLEENLAALCLLRSSPNLQELEMLARPEETGIGVLTNFWEVDHWTSLFSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASARAEIIYLDPQLQ
ccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHcccccccccccEECccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEEcEECcccccccccccccEEEEEEEEEcccHHHHHHHccccccEEEEEECcccEEEEEEcccEEEEEEEEECccEEEEEccccEEEEEEEECcccccccccccccHHHHHHHHcccccEEEEEEcEEEEEEECcccccccccccccEEEEEEEEEccccHHHHHHHHHHHccccccEEEEEECccccccccccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHcccccccccEEEEEccccc
******************RLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPHLVFDNHCVSTSSQDQTFIKNKLVNIVDHVLLLHNGPILKFKLSHRDLLGVSDIDRWILYMSRSCVKEFILEIWKGQRYKVPSSLFLCQNLIHLELFNCLLKPPSTFKGFRNLKSLDLQHITLSQDVFENLISSSPTLERLTLMNFDGFTHLNIDAPNLQFFDIGGVFDDVTFENTFHLALVSIGLYVNVKNDQAMGPGNSCKLLRFFVHLPHIRRLEIQSYFLKYLAIGNVPSRLPRPCVDLNYLSIRINFNDLEENLAALCLLRSSPNLQELEMLARPEETGIGVLTNFWEVDHWTSLFSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASARAEIIYLDPQL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKXREPPKFPCKLETELDRLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPHLVFDNHCVSTSSQDQTFIKNKLVNIVDHVLLLHNGPILKFKLSHRDLLGVSDIDRWILYMSRSCVKEFILEIWKGQRYKVPSSLFLCQNLIHLELFNCLLKPPSTFKGFRNLKSLDLQHITLSQDVFENLISSSPTLERLTLMNFDGFTHLNIDAPNLQFFDIGGVFDDVTFENTFHLALVSIGLYVNVKNDQAMGPGNSCKLLRFFVHLPHIRRLEIQSYFLKYLAIGNVPSRLPRPCVDLNYLSIRINFNDLEENLAALCLLRSSPNLQELEMLARPEETGIGVLTNFWEVDHWTSLFSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASARAEIIYLDPQLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/FBD/LRR-repeat protein At1g13570 probableQ9FZ70

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6Q, chain A
Confidence level:confident
Coverage over the Query: 123-251,262-399
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:confident
Coverage over the Query: 24-204
View the alignment between query and template
View the model in PyMOL
Template: 1Z7X, chain W
Confidence level:confident
Coverage over the Query: 95-399
View the alignment between query and template
View the model in PyMOL