Citrus Sinensis ID: 014159


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MEDSSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQINPKLQDLQKREGEAGRKKVLQYTRYASVGFAIVQAIGQVLYLRPYVNDFSTDWVLTSVTLLTLGSAFTTYIGERISDLKLGNGTSLLIFTSIISYLPASFGRTVAEAFQDGNYIGLATIIISFILLVLGIVYVQEAERKIPINYASRYTSRSGGLQRSAYLPFKVNSSGVMPIIFSTSSLALPGTLARFTGIAALKKAAVALNPGGSFYLPTNILLIAFFNYYYTFLQLDPDDVSEQLKRQGASIPLVRPGKSTAAFLKTVLSRISVLGSVFLAILAAGPAVIEQTTHLTAFRGFAGTSVLILVGCATDTARKVQAEIISQKYKNIEFYDIDSYGS
cccccccHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHccccHHHHHHHHHccccHHcHHHHHHHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcEEECccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEHHHHcHHHHHHHHHHHHccccccccccccccc
*****IDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQINPKLQDLQK****AGRKKVLQYTRYASVGFAIVQAIGQVLYLRPYVNDFSTDWVLTSVTLLTLGSAFTTYIGERISDLKLGNGTSLLIFTSIISYLPASFGRTVAEAFQDGNYIGLATIIISFILLVLGIVYVQEAERKIPINYASRYTSRSGGLQRSAYLPFKVNSSGVMPIIFSTSSLALPGTLARFTGIAALKKAAVALNPGGSFYLPTNILLIAFFNYYYTFLQLDPDDVSEQLKRQGASIPLVRPGKSTAAFLKTVLSRISVLGSVFLAILAAGPAVIEQTTHLTAFRGFAGTSVLILVGCATDTARKVQAEIISQKYKNIEFYDI*****
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDSSIDFGDFFKGPLPGKFLKLLGYLALSRLGIYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQINPKLQDLQKREGEAGRKKVLQYTRYASVGFAIVQAIGQVLYLRPYVNDFSTDWVLTSVTLLTLGSAFTTYIGERISDLKLGNGTSLLIFTSIISYLPASFGRTVAEAFQDGNYIGLATIIISFILLVLGIVYVQEAERKIPINYASRYTSRSGGLQRSAYLPFKVNSSGVMPIIFSTSSLALPGTLARFTGIAALKKAAVALNPGGSFYLPTNILLIAFFNYYYTFLQLDPDDVSEQLKRQGASIPLVRPGKSTAAFLKTVLSRISVLGSVFLAILAAGPAVIEQTTHLTAFRGFAGTSVLILVGCATDTARKVQAEIISQKYKNIEFYDIDSYGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Preprotein translocase subunit SECY, chloroplastic The central subunit of the protein translocation channel SecYE. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug.confidentQ6ZG25
Preprotein translocase subunit SCY1, chloroplastic Involved in protein export. Probably interacts with other proteins to allow the translocation of proteins across the chloroplast thylakoid membranes. Required for normal greening during embryogenesis. Central subunit of the protein translocation channel SecYE. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug.probableQ38885
Preprotein translocase subunit SECY, chloroplastic The central subunit of the protein translocation channel SecYE. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug.probableQ9XQU4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DL8, chain G
Confidence level:very confident
Coverage over the Query: 11-42,56-419
View the alignment between query and template
View the model in PyMOL