Citrus Sinensis ID: 014195

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MGRSFVGKNSTTPSPARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLNS
ccccccccccccccccEEEEEEHHHHHHHHHHcccEEcccccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEEEccccccEEEccccccccccccEEEEccEEEEEcccccccccccEEEEEEcccccEEccccccccccccEEEEEEEccEEEEEcccccccccccccEEEEEEcccccEEccccccccccccEEEEEccEEEEEcccccccccccEEEccccEEEcccccccEEEcccccccccccEEEEEccEEEEEcccccccccccccccccccccccEEEEEEEEEcccccEEEccccccccccccEEEEEEccEEEEEEccccccccccccEEccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEEccccccccccccEEEccccEEEcccccc
ccccEEccccccccccHHEHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEccccccccHcccccccccccccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccccccccccccccccccEEEEEcccEEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEEEccccccccccccccccccccccEEEEEEccEEEEEEccccccccccccccEEcccccEEEcccEEEcccccccEEccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEEEEEEccccccEEEccccccccccEEEEEEccEEEEEEccccccccccccccEEccEEEEEEEccc
mgrsfvgknsttpspaRVVLSIFVMILGFALVADFfwassskftssylniasnwspyhnsiilpnngpqkgenigvktkkdvvpkrilpatfqdlpapelkwekmkaapvprldgaAIQIKNLLYVFAGygsidyvhshvdiynftdntwggrfdmpremahshlgmvTDGRYIYVVtgqygpqcrgptahtfvldtetkkwqdlpplpvpryapatqlWRGRLhvmggsgenrytpevdhwslavkdgkplekewrteipiprggphracvvvddrllviggqegdfmakpgspifkcsrrnevvyddvymlddemkwkvlpsmpkpdshiEFAWVLVNNSIVIVggttekhpttkKMVLVGEIFQFNLNTLKwhvigklpyrvKTTLAGYWNgwlyftsgqrdkgpddpaprkvhgdmwrtkLLLNS
mgrsfvgknsttpsparVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILpatfqdlpapelKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTEtkkwqdlpplpvPRYAPATQLWRGRLHVMGGSGENrytpevdhwslavkdgkplekewrteipiprggphraCVVVDDRLLVIGGQEgdfmakpgspifkcsrrneVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFtsgqrdkgpddpaprkvhgdmwrtklllns
MGRSFVGKNSTTPSPARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLNS
****************RVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPN********IGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFT*****************************
**************PARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIIL***************KKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLL**
************PSPARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLNS
************PSPARVVLSIFVMILGFALVADFFWASSSKF*SSYLNIASNWSPYHNSIILPN*************KKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLN*
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRSFVGKNSTTPSPARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query429 2.2.26 [Sep-21-2011]
Q9LK31426 Kelch repeat-containing p no no 0.946 0.953 0.647 1e-157
Q5ZKD9610 Kelch-like protein 20 OS= yes no 0.582 0.409 0.243 2e-08
Q6DFF6604 Kelch-like protein 20 OS= N/A no 0.582 0.413 0.243 3e-08
Q5XIA9354 Kelch domain-containing p yes no 0.680 0.824 0.212 4e-08
Q8VCK5604 Kelch-like protein 20 OS= yes no 0.582 0.413 0.239 7e-08
D3Z8N4609 Kelch-like protein 20 OS= no no 0.582 0.410 0.239 8e-08
Q9Y2M5609 Kelch-like protein 20 OS= yes no 0.582 0.410 0.239 8e-08
Q08DK3609 Kelch-like protein 20 OS= yes no 0.582 0.410 0.239 8e-08
B4J045624 Kelch-like protein diablo N/A no 0.396 0.272 0.245 1e-07
B4L0G9617 Kelch-like protein diablo N/A no 0.396 0.275 0.245 1e-07
>sp|Q9LK31|Y3272_ARATH Kelch repeat-containing protein At3g27220 OS=Arabidopsis thaliana GN=At3g27220 PE=1 SV=1 Back     alignment and function desciption
 Score =  555 bits (1429), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/417 (64%), Positives = 324/417 (77%), Gaps = 11/417 (2%)

Query: 14  SPARVVLSI-FVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSII----LPNNGP 68
           S  R++L + F  +LG   +A F   SSS    S   + S W P +   I    + +   
Sbjct: 14  SSRRLMLVLYFTSVLGIGFIAAFLCLSSS--IPSVSAVFSIWVPVNRPEIQIPIIDSKIV 71

Query: 69  QKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFA 128
           QK       TK  V   R L A F D+PAPELKWE+M++APVPRLDG ++QI NLLYVF+
Sbjct: 72  QKRSKQSNDTKDHV---RFLSAIFADIPAPELKWEEMESAPVPRLDGYSVQINNLLYVFS 128

Query: 129 GYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGP 188
           GYGS+DYVHSHVD++NFTDN W  RF  P+EMA+SHLG+VTDGRY+YVV+GQ GPQCRGP
Sbjct: 129 GYGSLDYVHSHVDVFNFTDNKWCDRFHTPKEMANSHLGIVTDGRYVYVVSGQLGPQCRGP 188

Query: 189 TAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKD 248
           T+ +FVLD+ TK W + P LP PRYAPATQ+WRGRLHVMGGS ENR     DHWS+AVKD
Sbjct: 189 TSRSFVLDSFTKTWLEFPSLPAPRYAPATQIWRGRLHVMGGSKENRNAVAFDHWSIAVKD 248

Query: 249 GKPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYD 308
           GK L+ EWR E+PIPRGGPHRACVV +D+LLVIGGQEGDFMAKP SPIFKCSRR E+   
Sbjct: 249 GKALD-EWREEVPIPRGGPHRACVVANDKLLVIGGQEGDFMAKPNSPIFKCSRRREIFNG 307

Query: 309 DVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQF 368
           +VYM+D+EMKWK+LP MPK +SHIE AW++VNNSIVIVGGTT+ HP TK++VLVGEIF+F
Sbjct: 308 EVYMMDEEMKWKMLPPMPKNNSHIESAWIIVNNSIVIVGGTTDWHPVTKRLVLVGEIFRF 367

Query: 369 NLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKL 425
            L+TL W VIG+LPYRVKT +AG+WNG+LYFTSGQRD+GPD+P P KV G+MWRTKL
Sbjct: 368 QLDTLTWSVIGRLPYRVKTAMAGFWNGYLYFTSGQRDRGPDNPQPGKVIGEMWRTKL 424

Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIA9|KLD8B_RAT Kelch domain-containing protein 8B OS=Rattus norvegicus GN=Klhdc8b PE=2 SV=1 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description
>sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
225443351426 PREDICTED: kelch repeat-containing prote 0.948 0.955 0.803 0.0
224113255424 predicted protein [Populus trichocarpa] 0.951 0.962 0.792 0.0
12325370 1036 unknown protein; 27363-23366 [Arabidopsi 0.946 0.391 0.766 0.0
255561818425 conserved hypothetical protein [Ricinus 0.960 0.969 0.772 0.0
296090252431 unnamed protein product [Vitis vinifera] 0.948 0.944 0.771 0.0
224097430424 predicted protein [Populus trichocarpa] 0.955 0.966 0.782 0.0
225452169423 PREDICTED: kelch repeat-containing prote 0.944 0.957 0.773 0.0
145336621415 kelch-like motif-containing protein [Ara 0.948 0.980 0.765 0.0
449453359427 PREDICTED: kelch repeat-containing prote 0.974 0.978 0.773 0.0
297830804409 hypothetical protein ARALYDRAFT_318850 [ 0.927 0.973 0.772 0.0
>gi|225443351|ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/413 (80%), Positives = 369/413 (89%), Gaps = 6/413 (1%)

Query: 19  VLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWS--PYHNSIILPNNGPQKG-ENIG 75
           V+S F  +L   LVAD  WASS   +S Y +IA+NW+     +++I+P+  PQK  E   
Sbjct: 16  VISCF-GLLAAGLVADLLWASSKS-SSGYHSIATNWAFDDSRSTVIVPHQQPQKAKEGSD 73

Query: 76  VKTKKDV-VPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSID 134
           VK KK   VP+R+L ATF DLPAPEL+WEKM  APVPRLDGAAIQIKNLLYVFAGYG+ID
Sbjct: 74  VKDKKKADVPERVLSATFADLPAPELEWEKMAPAPVPRLDGAAIQIKNLLYVFAGYGTID 133

Query: 135 YVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFV 194
           +VHSHVD+YNFTDNTWGGRFDMP+EMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTA TFV
Sbjct: 134 FVHSHVDVYNFTDNTWGGRFDMPKEMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTARTFV 193

Query: 195 LDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEK 254
           LDT+TK+W D+PPLPVPRYAPATQLWRGRLHVMGGSGENR+TP ++HWSLAVK+GK LEK
Sbjct: 194 LDTKTKQWSDMPPLPVPRYAPATQLWRGRLHVMGGSGENRHTPALEHWSLAVKNGKALEK 253

Query: 255 EWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD 314
           EWR+EIPIPRGGPHRAC+VVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVV+ DVYMLD
Sbjct: 254 EWRSEIPIPRGGPHRACIVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVFSDVYMLD 313

Query: 315 DEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLK 374
           DEMKWK LP MPKPDSHIEFAWV+VN+SI+IVGGTTEKHP TKKMVLVGE+FQFNL++LK
Sbjct: 314 DEMKWKNLPPMPKPDSHIEFAWVMVNHSIIIVGGTTEKHPITKKMVLVGEVFQFNLDSLK 373

Query: 375 WHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLL 427
           W VIGKLPYRVKTTLAG+WNGWLYFTSGQRDKGPDDPAP+KV G+MWRTKL L
Sbjct: 374 WSVIGKLPYRVKTTLAGFWNGWLYFTSGQRDKGPDDPAPKKVLGEMWRTKLSL 426

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224113255|ref|XP_002316438.1| predicted protein [Populus trichocarpa] gi|222865478|gb|EEF02609.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|12325370|gb|AAG52629.1|AC024261_16 unknown protein; 27363-23366 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255561818|ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|296090252|emb|CBI40071.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097430|ref|XP_002310931.1| predicted protein [Populus trichocarpa] gi|222850751|gb|EEE88298.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225452169|ref|XP_002270625.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] Back     alignment and taxonomy information
>gi|145336621|ref|NP_175565.2| kelch-like motif-containing protein [Arabidopsis thaliana] gi|28416695|gb|AAO42878.1| At1g51540 [Arabidopsis thaliana] gi|110743235|dbj|BAE99508.1| At1g51540 [Arabidopsis thaliana] gi|332194560|gb|AEE32681.1| kelch-like motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449453359|ref|XP_004144425.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297830804|ref|XP_002883284.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] gi|297329124|gb|EFH59543.1| hypothetical protein ARALYDRAFT_318850 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query429
TAIR|locus:2033944415 AT1G51540 [Arabidopsis thalian 0.946 0.978 0.766 4.5e-178
TAIR|locus:2086528426 AT3G27220 "AT3G27220" [Arabido 0.946 0.953 0.649 2.7e-148
UNIPROTKB|G4N9D1338 MGG_10013 "Uncharacterized pro 0.689 0.875 0.244 1.3e-12
MGI|MGI:2442630350 Klhdc8a "kelch domain containi 0.445 0.545 0.271 1.3e-08
UNIPROTKB|Q6DFF6604 klhl20 "Kelch-like protein 20" 0.400 0.284 0.252 2.6e-08
UNIPROTKB|F1NMM8609 KLHL20 "Kelch-like protein 20" 0.400 0.282 0.252 2.6e-08
UNIPROTKB|Q5ZKD9610 KLHL20 "Kelch-like protein 20" 0.400 0.281 0.252 2.6e-08
UNIPROTKB|F1NGH0617 KLHL20 "Kelch-like protein 20" 0.400 0.278 0.252 2.7e-08
ZFIN|ZDB-GENE-040426-1935591 klhl20 "kelch-like 20 (Drosoph 0.400 0.291 0.252 3.2e-08
UNIPROTKB|B4DUR0420 KLHL20 "Kelch-like protein 20" 0.400 0.409 0.247 3.8e-08
TAIR|locus:2033944 AT1G51540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1729 (613.7 bits), Expect = 4.5e-178, P = 4.5e-178
 Identities = 316/412 (76%), Positives = 357/412 (86%)

Query:    17 RVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGV 76
             +VVL   + +L   L+ADF WA+S +F+S+ ++   +      ++I+P      G+    
Sbjct:     9 KVVLVSCIALLATGLIADFLWATSHRFSSAAISAGLSLPSSLTTVIVP------GQEKDT 62

Query:    77 KTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYV 136
             K KKD V +R L  TFQDLPAPELKWEKM A+PVPRLDGAAIQI++LLYVFAGYG+ID V
Sbjct:    63 KKKKDSVKERKLSNTFQDLPAPELKWEKMAASPVPRLDGAAIQIRDLLYVFAGYGTIDLV 122

Query:   137 HSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTFVLD 196
             HSHVDIYNFTDN+WGGRF+MP++MAHSHLGMVTDGRYIY+VTGQ+GPQCRGPTA TFVLD
Sbjct:   123 HSHVDIYNFTDNSWGGRFNMPKDMAHSHLGMVTDGRYIYIVTGQFGPQCRGPTAKTFVLD 182

Query:   197 TETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEW 256
             T+T  W+D  PLPVPRYAPATQLWRGRLHVMGGS ENR+TP ++HWS+AVKDGK LE EW
Sbjct:   183 TDTNTWKDFVPLPVPRYAPATQLWRGRLHVMGGSKENRFTPGLEHWSIAVKDGKSLENEW 242

Query:   257 RTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDE 316
             R+EIPIPRGGPHRACVVVDDRL VIGGQEGDFMAKPGSPIFKCSRR EVV+ DVYMLD+E
Sbjct:   243 RSEIPIPRGGPHRACVVVDDRLFVIGGQEGDFMAKPGSPIFKCSRRMEVVFSDVYMLDEE 302

Query:   317 MKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWH 376
             MKWKV+P MPKPDSHIEFAW +VNNSIVIVGGTTEKHP TKKMVLVGEIFQFNLNTLKW+
Sbjct:   303 MKWKVMPPMPKPDSHIEFAWKVVNNSIVIVGGTTEKHPETKKMVLVGEIFQFNLNTLKWY 362

Query:   377 VIGKLPYRVKTTLAGYWNGWLYFTSGQRDKGPDDPAPRKVHGDMWRTKLLLN 428
             VIGKLPYRVKTTLAGYW+G LYFTSGQRDKGPDDPAPRKV  +MWRTKL+LN
Sbjct:   363 VIGKLPYRVKTTLAGYWDGQLYFTSGQRDKGPDDPAPRKVMAEMWRTKLILN 414
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2086528 AT3G27220 "AT3G27220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N9D1 MGG_10013 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:2442630 Klhdc8a "kelch domain containing 8A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DFF6 klhl20 "Kelch-like protein 20" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMM8 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKD9 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGH0 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1935 klhl20 "kelch-like 20 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DUR0 KLHL20 "Kelch-like protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.n1LOW CONFIDENCE prediction!
3rd Layer5.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00102345
hypothetical protein (425 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-13
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-08
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 5e-08
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 9e-07
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-05
smart0061247 smart00612, Kelch, Kelch domain 3e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.003
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.003
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 0.003
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 71.7 bits (176), Expect = 2e-13
 Identities = 50/187 (26%), Positives = 76/187 (40%), Gaps = 36/187 (19%)

Query: 196 DTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKE 255
           DT+TK W  +P L  PR  P   ++  R++V+GG   +     V+ W       KP E +
Sbjct: 317 DTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSISLNTVESW-------KPGESK 369

Query: 256 WRTEIPI--PRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYML 313
           WR E P+  PR  P    V V++ + VIGG            I K    N+ +   V   
Sbjct: 370 WREEPPLIFPRYNP--CVVNVNNLIYVIGG------------ISK----NDELLKTVECF 411

Query: 314 D-DEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGGTT-EKHPTTKKMVLVGEIFQFNLN 371
             +  KW      P P SH     +  +  I ++GG +   +     +V       +N  
Sbjct: 412 SLNTNKWSKG--SPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIV-----ESYNPV 464

Query: 372 TLKWHVI 378
           T KW  +
Sbjct: 465 TNKWTEL 471

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 429
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.95
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.91
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.86
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.66
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.57
PF1396450 Kelch_6: Kelch motif 99.32
PF1396450 Kelch_6: Kelch motif 99.32
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.17
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.05
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.04
PF1341549 Kelch_3: Galactose oxidase, central domain 99.0
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.96
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.94
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.88
smart0061247 Kelch Kelch domain. 98.82
smart0061247 Kelch Kelch domain. 98.72
PF1385442 Kelch_5: Kelch motif 98.62
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.61
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.58
PLN02772398 guanylate kinase 98.53
PLN02772 398 guanylate kinase 98.51
PF1385442 Kelch_5: Kelch motif 98.39
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.37
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.24
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.23
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.03
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.02
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.97
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.8
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.33
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.05
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.99
PRK13684334 Ycf48-like protein; Provisional 96.93
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.09
PF12768281 Rax2: Cortical protein marker for cell polarity 96.05
PF12768281 Rax2: Cortical protein marker for cell polarity 95.92
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.68
KOG2055514 consensus WD40 repeat protein [General function pr 94.84
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.39
PLN00033398 photosystem II stability/assembly factor; Provisio 94.22
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.84
PRK13684334 Ycf48-like protein; Provisional 93.53
PRK11028330 6-phosphogluconolactonase; Provisional 93.33
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.3
KOG2055 514 consensus WD40 repeat protein [General function pr 93.16
PF12217367 End_beta_propel: Catalytic beta propeller domain o 93.12
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 92.89
KOG0310 487 consensus Conserved WD40 repeat-containing protein 91.85
PRK04792448 tolB translocation protein TolB; Provisional 91.59
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 91.49
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.42
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.11
KOG0310 487 consensus Conserved WD40 repeat-containing protein 90.67
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 89.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 89.24
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 88.9
PLN00181793 protein SPA1-RELATED; Provisional 88.82
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 88.57
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.56
PRK05137435 tolB translocation protein TolB; Provisional 88.45
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 88.11
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 87.68
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 87.11
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.49
PRK11028330 6-phosphogluconolactonase; Provisional 86.46
PRK04792448 tolB translocation protein TolB; Provisional 85.97
smart00284255 OLF Olfactomedin-like domains. 85.78
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 85.39
PRK05137435 tolB translocation protein TolB; Provisional 85.33
PRK00178430 tolB translocation protein TolB; Provisional 85.16
PRK04922433 tolB translocation protein TolB; Provisional 84.3
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.17
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 84.06
PRK00178430 tolB translocation protein TolB; Provisional 84.05
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 83.77
KOG0649325 consensus WD40 repeat protein [General function pr 83.46
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 82.85
PF09910339 DUF2139: Uncharacterized protein conserved in arch 82.41
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 81.44
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 81.18
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 80.9
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 80.8
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-47  Score=382.39  Aligned_cols=264  Identities=20%  Similarity=0.368  Sum_probs=232.5

Q ss_pred             ccccccccCCCeEEccCCCCCccCCcEEEECCEEEEEeccCCCCceeeeEEEEECCCCceeeCCCCCCCCccceeeEEEe
Q 014195           91 TFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTD  170 (429)
Q Consensus        91 ~~~~~d~~~~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~~~~  170 (429)
                      .++.||+.++.|..+++||.+|..+++++++++||++||.+.....++++|+||+.+++|+.+++|+.  +|..++++++
T Consensus       302 ~ve~yd~~~~~w~~~a~m~~~r~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~a~M~~--~R~~~~v~~l  379 (571)
T KOG4441|consen  302 SVECYDPKTNEWSSLAPMPSPRCRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPVAPMNT--KRSDFGVAVL  379 (571)
T ss_pred             eeEEecCCcCcEeecCCCCcccccccEEEECCEEEEEccccCCCcccceEEEecCCCCceeccCCccC--ccccceeEEE
Confidence            34444568889999999999999999999999999999999433346789999999999999999999  8999999999


Q ss_pred             CCEEEEEeCeeCCCCCCCCceeEEEeCCCCceEeCCCCCCCCCCceEEEECCEEEEEeCCCCCC-CCccccceEeeeecC
Q 014195          171 GRYIYVVTGQYGPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENR-YTPEVDHWSLAVKDG  249 (429)
Q Consensus       171 ~~~lyv~GG~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~-~~~~~~~~~~~~~~~  249 (429)
                      ++.||++||.++...   ++++++|||.+++|+.+++|+.+|+.|++++++++||++||.++.. +..++++|       
T Consensus       380 ~g~iYavGG~dg~~~---l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~Y-------  449 (571)
T KOG4441|consen  380 DGKLYAVGGFDGEKS---LNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECY-------  449 (571)
T ss_pred             CCEEEEEeccccccc---cccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEE-------
Confidence            999999999997665   8899999999999999999999999999999999999999988765 55555555       


Q ss_pred             CccccceeeccCCCCCCCceeEEEeCCEEEEEcccCCCCCCCCCCCccccccCCeeeeCceEEeC-CCCCeEEcCCCCCC
Q 014195          250 KPLEKEWRTEIPIPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD-DEMKWKVLPSMPKP  328 (429)
Q Consensus       250 d~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d-~~~~W~~~~~~~~~  328 (429)
                      ||.+++|+..++|+..|.++++++++++||++||.++..                 ....+++|| .+++|+.+++|+.+
T Consensus       450 DP~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~-----------------~~~~VE~ydp~~~~W~~v~~m~~~  512 (571)
T KOG4441|consen  450 DPETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTS-----------------ALSSVERYDPETNQWTMVAPMTSP  512 (571)
T ss_pred             cCCCCceeecCCcccccccceEEEECCEEEEECCccCCC-----------------ccceEEEEcCCCCceeEcccCccc
Confidence            599999999999999999999999999999999998632                 244599999 99999999999999


Q ss_pred             CCCcceeEEEECCEEEEEcccCCCCCCccceeeeCcEEEEecCCCCeEEecccCcceeeeeeEE
Q 014195          329 DSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGY  392 (429)
Q Consensus       329 r~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~~i~~yd~~~~~W~~v~~lp~~r~~~~~~~  392 (429)
                      |..+++  ++++++||++||+++..       +++.++.|||++++|+...++...|...++++
T Consensus       513 rs~~g~--~~~~~~ly~vGG~~~~~-------~l~~ve~ydp~~d~W~~~~~~~~~~~~~~~~~  567 (571)
T KOG4441|consen  513 RSAVGV--VVLGGKLYAVGGFDGNN-------NLNTVECYDPETDTWTEVTEPESGRGGAGVAV  567 (571)
T ss_pred             cccccE--EEECCEEEEEecccCcc-------ccceeEEcCCCCCceeeCCCccccccCcceEE
Confidence            997654  89999999999988776       68899999999999999988555555554443

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-07
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 4e-06
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 6e-05
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 6e-04
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 6e-04
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 107/290 (36%), Gaps = 40/290 (13%)
Query: 89  PATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDN 148
           P + +     +  W  ++     R D A +   N++Y+  G  S  +    +D YN   +
Sbjct: 23  PQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGG--SQLFPIKRMDCYNVVKD 80
Query: 149 TWGGRFD--MPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGPTAHTF-VLDTETKKWQDL 205
           +W  +     PR+   S      +G+ IY   G    +      + F   DT T+ W   
Sbjct: 81  SWYSKLGPPTPRD---SLAACAAEGK-IYTSGGS---EVGNSALYLFECYDTRTESWHTK 133
Query: 206 PPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRG 265
           P +   R +       G ++V GGS  N  +  V + S  V D  P  + W    P+   
Sbjct: 134 PSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLN-SCEVYD--PATETWTELCPMIEA 190
Query: 266 GPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSM 325
             +   V V D++  +GGQ G                + V Y D+ +     +WK++  M
Sbjct: 191 RKNHGLVFVKDKIFAVGGQNG------------LGGLDNVEYYDIKL----NEWKMVSPM 234
Query: 326 PKPDSHIEFAWVLVNNSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKW 375
           P         W  V      VG         + +  +G I ++N  T KW
Sbjct: 235 P---------WKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKW 275
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query429
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-39
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-18
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-14
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-23
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-13
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-28
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-28
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-27
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-22
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-08
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 6e-24
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-18
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-12
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-08
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 5e-19
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-07
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-18
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-17
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 3e-08
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 9e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 5e-04
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
 Score =  142 bits (360), Expect = 6e-39
 Identities = 64/340 (18%), Positives = 102/340 (30%), Gaps = 58/340 (17%)

Query: 109 PVPRLDGAAIQIKNLLYVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMV 168
           PVP   G      + +Y+  G         +       D  W      P           
Sbjct: 7   PVPFKSGTGAIDNDTVYIGLGSAG---TAWYKLDTQAKDKKWTALAAFPGGPRDQATSAF 63

Query: 169 TDGRYIYVVTGQYGPQCRGPTAHT--FVLDTETKKWQDL-PPLPVPRYAPATQLWRGRLH 225
            DG  +YV  G                  + +T  W  L    P+      T +  G+ +
Sbjct: 64  IDGN-LYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVHNGKAY 122

Query: 226 VMGGSGENRYTPEVDHWSLAVKDGKPLEK---------------------------EWRT 258
           V GG  +N +    +  + A KD   ++K                           +W  
Sbjct: 123 VTGGVNQNIFNGYFEDLNEAGKDSTAIDKINAHYFDKKAEDYFFNKFLLSFDPSTQQWSY 182

Query: 259 EIPIPRGGPHRACVVV-DDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLDDEM 317
               P  G   A VV   D+  +I G+     AKPG       R + V   ++    + +
Sbjct: 183 AGESPWYGTAGAAVVNKGDKTWLINGE-----AKPG------LRTDAV--FELDFTGNNL 229

Query: 318 KWKVLPSMPKPDSHIEFAWVLVNNSIVIVG-----GTTEKHPTTKKMVLVGEIFQ----- 367
           KW  L  +  PD        + N+S++  G     G+ E +   K     G         
Sbjct: 230 KWNKLAPVSSPDGVAGGFAGISNDSLIFAGGAGFKGSRENYQNGKNYAHEGLKKSYSTDI 289

Query: 368 FNLNTLKWHVIGKLPYRVKTTLAGYWNGWLYFTSGQRDKG 407
              +  KW   G+L       ++  WN  L    G+   G
Sbjct: 290 HLWHNGKWDKSGELSQGRAYGVSLPWNNSLLIIGGETAGG 329
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.38
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.83
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.64
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.44
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.42
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.39
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.33
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.25
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.25
3jrp_A379 Fusion protein of protein transport protein SEC13 97.23
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.23
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.23
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.09
3jrp_A379 Fusion protein of protein transport protein SEC13 96.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.93
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.91
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.89
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.85
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.82
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.77
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.74
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.74
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.72
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.72
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.67
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.67
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.59
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.58
3jro_A 753 Fusion protein of protein transport protein SEC13 96.55
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.46
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.42
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.38
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.38
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.37
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 96.37
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.33
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.28
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.26
3jro_A 753 Fusion protein of protein transport protein SEC13 96.25
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.21
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.2
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.2
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.13
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.12
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.09
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.01
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.99
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.93
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.92
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.88
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.87
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.81
2pm7_B297 Protein transport protein SEC13, protein transport 95.81
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.8
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.79
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.69
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.63
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.59
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.58
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.58
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.51
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.51
2pm7_B297 Protein transport protein SEC13, protein transport 95.48
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.4
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.39
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.32
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.31
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.31
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.29
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.26
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.17
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.16
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.15
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.12
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.09
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.04
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.04
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 94.99
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.94
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.89
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.88
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.88
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.87
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.82
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.79
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.78
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 94.77
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 94.77
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.77
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.76
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.73
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.73
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.69
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.64
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.63
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.6
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 94.57
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.56
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.47
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.44
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.43
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.42
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.4
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.39
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.36
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.35
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.32
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.3
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.23
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.17
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.11
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.09
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.08
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.02
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.98
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.95
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 93.8
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.65
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.62
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.61
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.43
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.43
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 93.3
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 93.26
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.04
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.97
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 92.01
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.96
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.91
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 91.82
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 91.82
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.7
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 91.62
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 91.56
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 91.56
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.55
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.48
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 90.98
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 90.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.96
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.89
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.85
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.52
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.43
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 90.28
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 89.99
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.7
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 89.6
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 89.4
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.33
2ymu_A577 WD-40 repeat protein; unknown function, two domain 89.22
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 89.18
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 88.6
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 88.58
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 88.46
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 88.42
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 88.32
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 88.26
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 88.25
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 87.64
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 87.51
1itv_A195 MMP9; adaptive molecular recognition, beta propell 87.47
2ymu_A577 WD-40 repeat protein; unknown function, two domain 87.42
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 87.4
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 87.4
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 87.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 87.25
2xyi_A430 Probable histone-binding protein CAF1; transcripti 86.73
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 86.39
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.31
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 86.31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.14
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 85.88
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 85.59
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.51
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 84.74
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 84.61
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 84.33
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 83.95
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 83.77
3ott_A 758 Two-component system sensor histidine kinase; beta 83.73
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 82.91
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 82.25
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 82.08
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 81.9
1k32_A 1045 Tricorn protease; protein degradation, substrate g 81.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 81.37
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 80.87
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 80.85
1itv_A195 MMP9; adaptive molecular recognition, beta propell 80.59
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 80.4
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 80.11
2p4o_A306 Hypothetical protein; putative lactonase, structur 80.1
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=7.4e-50  Score=375.37  Aligned_cols=288  Identities=17%  Similarity=0.266  Sum_probs=245.0

Q ss_pred             HHHHHHhhcceeeeecCCCcccceeeeeeecCCCCeEEecCCCCCCCcceeeeecCCCCcCcccccccccccccCCCeEE
Q 014195           25 MILGFALVADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEK  104 (429)
Q Consensus        25 ~~~~~~~~~~~ly~~GG~~~~~~~~~~~~yd~~~~~~~~p~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~  104 (429)
                      ..|+++.+++.||++||. ....+++++                                         .||+.+++|+.
T Consensus        16 ~~~~~~~~~~~i~v~GG~-~~~~~~~~~-----------------------------------------~~d~~~~~W~~   53 (308)
T 1zgk_A           16 RGSHAPKVGRLIYTAGGY-FRQSLSYLE-----------------------------------------AYNPSNGTWLR   53 (308)
T ss_dssp             -----CCCCCCEEEECCB-SSSBCCCEE-----------------------------------------EEETTTTEEEE
T ss_pred             CCccccCCCCEEEEEeCc-CCCCcceEE-----------------------------------------EEcCCCCeEeE
Confidence            478899999999999997 333444444                                         45567889999


Q ss_pred             ccCCCCCccCCcEEEECCEEEEEeccC---CCCceeeeEEEEECCCCceeeCCCCCCCCccceeeEEEeCCEEEEEeCee
Q 014195          105 MKAAPVPRLDGAAIQIKNLLYVFAGYG---SIDYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQY  181 (429)
Q Consensus       105 ~~~~p~~R~~~~~~~~~~~iyv~GG~~---~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~~~~~~~lyv~GG~~  181 (429)
                      ++++|.+|..|+++.++++|||+||..   ......+++++||+.+++|+.++++|.  +|..|++++++++||++||.+
T Consensus        54 ~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~--~r~~~~~~~~~~~iyv~GG~~  131 (308)
T 1zgk_A           54 LADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSV--PRNRIGVGVIDGHIYAVGGSH  131 (308)
T ss_dssp             CCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSS--CCBTCEEEEETTEEEEECCEE
T ss_pred             CCCCCcccccceEEEECCEEEEECCCcCCCCCCeecceEEEECCCCCeEeECCCCCc--CccccEEEEECCEEEEEcCCC
Confidence            999999999999999999999999984   333456789999999999999999987  788999999999999999987


Q ss_pred             CCCCCCCCceeEEEeCCCCceEeCCCCCCCCCCceEEEECCEEEEEeCCCCCCCCccccceEeeeecCCccccceeeccC
Q 014195          182 GPQCRGPTAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIP  261 (429)
Q Consensus       182 ~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~  261 (429)
                      +...   .+++++||+.+++|+.++++|.+|..|+++.++++||++||.+......+++.|       |+.+++|+.+++
T Consensus       132 ~~~~---~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~y-------d~~~~~W~~~~~  201 (308)
T 1zgk_A          132 GCIH---HNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY-------YPERNEWRMITA  201 (308)
T ss_dssp             TTEE---CCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEE-------ETTTTEEEECCC
T ss_pred             CCcc---cccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCCCCCCcCceEEEE-------eCCCCeEeeCCC
Confidence            7543   789999999999999999999999999999999999999998765543333333       489999999999


Q ss_pred             CCCCCCceeEEEeCCEEEEEcccCCCCCCCCCCCccccccCCeeeeCceEEeC-CCCCeEEcCCCCCCCCCcceeEEEEC
Q 014195          262 IPRGGPHRACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD-DEMKWKVLPSMPKPDSHIEFAWVLVN  340 (429)
Q Consensus       262 ~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d-~~~~W~~~~~~~~~r~~~~~~~~~~~  340 (429)
                      +|.++..+++++++++|||+||.+...                 ..++++.|| .+++|+.++++|.+|..+.  +++++
T Consensus       202 ~p~~r~~~~~~~~~~~iyv~GG~~~~~-----------------~~~~v~~yd~~~~~W~~~~~~p~~r~~~~--~~~~~  262 (308)
T 1zgk_A          202 MNTIRSGAGVCVLHNCIYAAGGYDGQD-----------------QLNSVERYDVETETWTFVAPMKHRRSALG--ITVHQ  262 (308)
T ss_dssp             CSSCCBSCEEEEETTEEEEECCBCSSS-----------------BCCCEEEEETTTTEEEECCCCSSCCBSCE--EEEET
T ss_pred             CCCccccceEEEECCEEEEEeCCCCCC-----------------ccceEEEEeCCCCcEEECCCCCCCccceE--EEEEC
Confidence            999999999999999999999986432                 356899999 9999999999999988654  57889


Q ss_pred             CEEEEEcccCCCCCCccceeeeCcEEEEecCCCCeEEecccCcceeeeeeEE
Q 014195          341 NSIVIVGGTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGY  392 (429)
Q Consensus       341 ~~i~v~GG~~~~~~~~~~~~~~~~i~~yd~~~~~W~~v~~lp~~r~~~~~~~  392 (429)
                      ++|||+||.+...       .++++++||+++++|+.+++||.+|..|++++
T Consensus       263 ~~i~v~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~  307 (308)
T 1zgk_A          263 GRIYVLGGYDGHT-------FLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  307 (308)
T ss_dssp             TEEEEECCBCSSC-------BCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             CEEEEEcCcCCCc-------ccceEEEEcCCCCEEeecCCCCCCcccceeEe
Confidence            9999999987654       57899999999999999999999999998875
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 429
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-05
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 51.0 bits (120), Expect = 1e-07
 Identities = 39/359 (10%), Positives = 91/359 (25%), Gaps = 31/359 (8%)

Query: 11  TTPSPARVVLSIFVMILGFALVADFFWASSSKFTSSYLNIASNWSPYHN--SIILPNNGP 68
           T   P     +      G  L+   +   +   +   + + S+W P     S        
Sbjct: 14  TIDLPIVPAAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLTSSWDPSTGIVSDRTVTVTK 73

Query: 69  QKGENIGVKTKKD----VVPKRILPATFQDLPAPELKWEKMKAAPVPRLDGAAIQIKNLL 124
                 G+    +    V        T     + +                +A      +
Sbjct: 74  HDMFCPGISMDGNGQIVVTGGNDAKKTSLYDSSSDSWIPGPDMQVARGYQSSATMSDGRV 133

Query: 125 YVFAGYGSIDYVHSHVDIYNFTDNTWGGRFDMPREMAHS--HLGMVTDGRYIYVVTGQYG 182
           +   G  S      + ++Y+ +  TW    +       +    G+     + ++   + G
Sbjct: 134 FTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPMLTADKQGLYRSDNHAWLFGWKKG 193

Query: 183 P--QCRGPTAHTFVLDTETKKWQDLPPLPVPRY---------APATQLWRGRLHVMGGSG 231
              Q    TA  +   + +   +        R          A      +G++   GGS 
Sbjct: 194 SVFQAGPSTAMNWYYTSGSGDVKSAGKRQSNRGVAPDAMCGNAVMYDAVKGKILTFGGSP 253

Query: 232 ENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPHRACVV--VDDRLLVIGGQEGDFM 289
           + + +    +  +                            V   D    + GGQ     
Sbjct: 254 DYQDSDATTNAHIITLGEPGTSPNTVFASNGLYFARTFHTSVVLPDGSTFITGGQRRGIP 313

Query: 290 AKPGSPIFKCSRRNEVVYDDVYMLDDEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVGG 348
            +  +P+F        +Y       ++  +           +   + +L +  +   GG
Sbjct: 314 FEDSTPVFTP-----EIYVP-----EQDTFYKQNPNSIVRVYHSISLLLPDGRVFNGGG 362
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query429
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.9
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.84
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.63
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.99
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.81
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.57
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.49
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.35
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.18
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.17
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.01
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.8
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.7
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.65
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.44
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.4
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 94.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 94.05
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.01
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.9
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.62
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 92.5
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.44
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 92.24
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.89
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.68
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 91.68
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 91.29
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 90.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 90.77
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 90.39
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 90.36
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.02
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.5
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.63
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 88.32
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 86.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.59
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 86.48
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.28
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 85.45
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 85.23
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 85.04
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 83.43
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 80.46
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.3
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 80.02
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.6e-45  Score=336.64  Aligned_cols=281  Identities=18%  Similarity=0.312  Sum_probs=242.5

Q ss_pred             hcceeeeecCCCcccceeeeeeecCCCCeEEecCCCCCCCcceeeeecCCCCcCcccccccccccccCCCeEEccCCCCC
Q 014195           32 VADFFWASSSKFTSSYLNIASNWSPYHNSIILPNNGPQKGENIGVKTKKDVVPKRILPATFQDLPAPELKWEKMKAAPVP  111 (429)
Q Consensus        32 ~~~~ly~~GG~~~~~~~~~~~~yd~~~~~~~~p~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~  111 (429)
                      ++++||++||.+. ..++++++||                                         +.+++|+++++||.+
T Consensus         3 ~g~~iyv~GG~~~-~~~~~~~~yd-----------------------------------------~~t~~W~~~~~~p~~   40 (288)
T d1zgka1           3 VGRLIYTAGGYFR-QSLSYLEAYN-----------------------------------------PSNGTWLRLADLQVP   40 (288)
T ss_dssp             CCCCEEEECCBSS-SBCCCEEEEE-----------------------------------------TTTTEEEECCCCSSC
T ss_pred             cCCEEEEECCcCC-CCCceEEEEE-----------------------------------------CCCCeEEECCCCCCc
Confidence            4789999999764 3556666665                                         477789999999999


Q ss_pred             ccCCcEEEECCEEEEEeccCCC---CceeeeEEEEECCCCceeeCCCCCCCCccceeeEEEeCCEEEEEeCeeCCCCCCC
Q 014195          112 RLDGAAIQIKNLLYVFAGYGSI---DYVHSHVDIYNFTDNTWGGRFDMPREMAHSHLGMVTDGRYIYVVTGQYGPQCRGP  188 (429)
Q Consensus       112 R~~~~~~~~~~~iyv~GG~~~~---~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~~~~~~~lyv~GG~~~~~~~~~  188 (429)
                      |.+|++++++++|||+||....   ....+++++||+.+++|+.+++||.  +|..|++++.+++||++||..+...   
T Consensus        41 R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~--~r~~~~~~~~~~~i~~~gg~~~~~~---  115 (288)
T d1zgka1          41 RSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSV--PRNRIGVGVIDGHIYAVGGSHGCIH---  115 (288)
T ss_dssp             CBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSS--CCBTCEEEEETTEEEEECCEETTEE---
T ss_pred             cceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccc--eecceeccccceeeEEecceecccc---
Confidence            9999999999999999997432   3346789999999999999999987  7899999999999999999877654   


Q ss_pred             CceeEEEeCCCCceEeCCCCCCCCCCceEEEECCEEEEEeCCCCCCCCccccceEeeeecCCccccceeeccCCCCCCCc
Q 014195          189 TAHTFVLDTETKKWQDLPPLPVPRYAPATQLWRGRLHVMGGSGENRYTPEVDHWSLAVKDGKPLEKEWRTEIPIPRGGPH  268 (429)
Q Consensus       189 ~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~~~~  268 (429)
                      .++++.||+.+++|...+.++.+|..|+++.+++++|++||..........+.|       |+.+++|......+..+..
T Consensus       116 ~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~~~-------d~~~~~~~~~~~~~~~~~~  188 (288)
T d1zgka1         116 HNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY-------YPERNEWRMITAMNTIRSG  188 (288)
T ss_dssp             CCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEEEE-------ETTTTEEEECCCCSSCCBS
T ss_pred             cceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEEEe-------ecccccccccccccccccc
Confidence            788999999999999999999999999999999999999998765544444444       4889999999888888888


Q ss_pred             eeEEEeCCEEEEEcccCCCCCCCCCCCccccccCCeeeeCceEEeC-CCCCeEEcCCCCCCCCCcceeEEEECCEEEEEc
Q 014195          269 RACVVVDDRLLVIGGQEGDFMAKPGSPIFKCSRRNEVVYDDVYMLD-DEMKWKVLPSMPKPDSHIEFAWVLVNNSIVIVG  347 (429)
Q Consensus       269 ~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d-~~~~W~~~~~~~~~r~~~~~~~~~~~~~i~v~G  347 (429)
                      ++++..+++|+++||.....                 ..++.+.|| .+++|+.++++|.+|..+  ++++++++|||+|
T Consensus       189 ~~~~~~~~~i~i~GG~~~~~-----------------~~~~~~~~~~~~~~~~~~~~~p~~r~~~--~~~~~~~~l~v~G  249 (288)
T d1zgka1         189 AGVCVLHNCIYAAGGYDGQD-----------------QLNSVERYDVETETWTFVAPMKHRRSAL--GITVHQGRIYVLG  249 (288)
T ss_dssp             CEEEEETTEEEEECCBCSSS-----------------BCCCEEEEETTTTEEEECCCCSSCCBSC--EEEEETTEEEEEC
T ss_pred             ccccceeeeEEEecCccccc-----------------cccceeeeeecceeeecccCccCcccce--EEEEECCEEEEEe
Confidence            89999999999999986442                 456789999 999999999999998865  4578999999999


Q ss_pred             ccCCCCCCccceeeeCcEEEEecCCCCeEEecccCcceeeeeeEE
Q 014195          348 GTTEKHPTTKKMVLVGEIFQFNLNTLKWHVIGKLPYRVKTTLAGY  392 (429)
Q Consensus       348 G~~~~~~~~~~~~~~~~i~~yd~~~~~W~~v~~lp~~r~~~~~~~  392 (429)
                      |.+...       +++++|+||+++++|+.+++||.+|+.|++++
T Consensus       250 G~~~~~-------~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         250 GYDGHT-------FLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             CBCSSC-------BCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             cCCCCe-------ecceEEEEECCCCEEEECCCCCCCcEeEEEEE
Confidence            987655       57899999999999999999999999998764
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure