Citrus Sinensis ID: 014218

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MATSLANTTFFSKTCSLFIHTNSLKRFAFRVPFSSTSTSTSPLPLKKKWRPPAASALELGGVKMAKDDIVRDDPTNNVPDTIFTKLGMQLHKRNQHPIGILKNAIYEYFDSNYPNKFNKFDDLCPIVSVKQNFDDVLVPADHVSRSYNDTYYVDSQTVLRCHTSAHQAELLKEHNHFLVTGDVYRRDSIDSTHYPVFHQMEGVSIFYPDEWGAAGLDATEYAAKDLKRCLEGLARHLFGAVEMRWVDTYFPFTNPSYELEIFFKENWLEVLGCGVTEQEILKRSGKLNNVAWAFGLGLERLAMVLFDIPDIRLFWSSDERFTSQFSQGQLGIKFKPFSKYPPCYKDMSFWINESFTENNLCEVVRGVAGDLVEEVRLIDNFTNKKGMTSHCYRIAYRSMERSLTDEDINELQWNVREQVQSKLNVVLR
ccccccccccccccccHHHccccHHHHccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEccccEEcccccHHHHHHHHccccEEECccEEEccccccccccccEEEcEEEEEccccccccccccHHccHHHHHHHHHHHHHHHHccccEEEEccccccccccccEEEEEcccEEEEEEccccHHHHHHHcccccccEEEEcccHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccccccEEECccccccccHHHHHHHccccEEEEEEEEEEECcccccCEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEc
******NTTFFSKTCSLFIHTNSLKRFAFRVPF***********************************IVRDDPTNNVPDTIFTKLGMQLHKRNQHPIGILKNAIYEYFDSNYPNKFNKFDDLCPIVSVKQNFDDVLVPADHVSRSYNDTYYVDSQTVLRCHTSAHQAELLKEHNHFLVTGDVYRRDSIDSTHYPVFHQMEGVSIFYPDEWGAAGLDATEYAAKDLKRCLEGLARHLFGAVEMRWVDTYFPFTNPSYELEIFFKENWLEVLGCGVTEQEILKRSGKLNNVAWAFGLGLERLAMVLFDIPDIRLFWSSDERFTSQFSQGQLGIKFKPFSKYPPCYKDMSFWINESFTENNLCEVVRGVAGDLVEEVRLIDNFTNKKGMTSHCYRIAYRSMERSLTDEDINELQWNVREQVQSKLNVVLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLANTTFFSKTCSLFIHTNSLKRFAFRVPFSSTSTSTSPLPLKKKWRPPAASALELGGVKMAKDDIVRDDPTNNVPDTIFTKLGMQLHKRNQHPIGILKNAIYEYFDSNYPNKFNKFDDLCPIVSVKQNFDDVLVPADHVSRSYNDTYYVDSQTVLRCHTSAHQAELLKEHNHFLVTGDVYRRDSIDSTHYPVFHQMEGVSIFYPDEWGAAGLDATEYAAKDLKRCLEGLARHLFGAVEMRWVDTYFPFTNPSYELEIFFKENWLEVLGCGVTEQEILKRSGKLNNVAWAFGLGLERLAMVLFDIPDIRLFWSSDERFTSQFSQGQLGIKFKPFSKYPPCYKDMSFWINESFTENNLCEVVRGVAGDLVEEVRLIDNFTNKKGMTSHCYRIAYRSMERSLTDEDINELQWNVREQVQSKLNVVLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phenylalanine--tRNA ligase, chloroplastic/mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.confidentQ94K73
Phenylalanine--tRNA ligase, mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.probableO74952
Phenylalanine--tRNA ligase, mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.probableQ86A68

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.20Phenylalanine--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMQ, chain A
Confidence level:very confident
Coverage over the Query: 55-428
View the alignment between query and template
View the model in PyMOL