Citrus Sinensis ID: 014251

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

MAGAASALFLLDIKGRVLIWRDYRGDVSAIQAERFFTKFIEKEGDPQSQNPVVFDNGVTYMFIQHNNVYLMAASRQNCNAASILLFLHRVADVFKHYFEELEEESLRDNFVVVYELLDEIMDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRVLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSARYAPENDALVWKIKSFPGNKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM

cccEEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHcccccccccEEEEccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccccccccEECccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEccccCEEEECcccHHHHHccccccccEEEEEcccccccccccccccccEEEEEcccccEEEEEEEEcccccccEEEEEEEEEcccEEEEEEEEEEEcccccccCEEEEEEccccccccccEEEEcccEEEECccccEEEEEEccccccccEEEEEEECccccccccccccccccEEEEEEEccccccccEEEEEEEEEcccccccccEEEEEEEccEEEEcc

*AGAASALFLLDIKGRVLIWRDYRGDVSAIQAERFFTKFIEKEGDPQSQNPVVFDNGVTYMFIQHNNVYLMAASRQNCNAASILLFLHRVADVFKHYFEELEEESLRDNFVVVYELLDEIMDFGFPQFTEAKILSEFIKTDAY****TQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRVLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAQIERHSRSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSARYAPENDALVWKIKSFPGNKEYMLRAEFSLPSI**********APIRVKFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
AP-1 complex subunit mu-1	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.	probable	P35585
AP-1 complex subunit mu-1-I	Required for many aspects of development and behavior, including negative regulation of vulval differentiation.	probable	P35602
AP-1 complex subunit mu	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Also involved in early steps of phagocytosis and macropinocytosis.	probable	Q54HS9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 4-148,159-219,234-365,378-427
View the alignment between query and template
View the model in PyMOL