Citrus Sinensis ID: 014260

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

MLEDMNLSINGQSQVPPGFRFHPTEEELLHYYLRKKVAYEKIDLDVIREVDLNKLEPWDIQEKCKIGSTPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYSGFRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRLEESNNQQQDIMINIQPSNSSIMGESSESIPEDGWVVCRVFRKKNYQKTLESPRTITSTSVMDSNNKSHMLIGSSNDAVLNQLLLYMGSGSCKMEKVNGGSSSNTTIMNSNDDDDDDMRITLTANINNNNSSITELLQERFMHLPRLELDGPSIPINSTSPFDQDRMLKSCYQTVDDLALTGTAEAAGIGCGASDTTKSTGLNDWVALDRLVASQLNGQVIDSSKQQLSCFSDSNAVFNFCPGDHDHLHNSQRSNQVYNNDNDLWSSFTKSSSSPSSSDPLCHLSV

ccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEEEEEcEEcccccccccccccEEEEEcccccccccccHHccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccccccccHHHHHHHHccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****************GFRFHPTEEELLHYYLRKKVAYEKIDLDVIREVDLNKLEPWDIQEKCKIGSTPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYSGFRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRLEESNNQQQ*********************PEDGWVVCRVFRKKN**********************************LNQLLLYMGS*******************************************ITELLQERFMHLPRL******************************************************LNDWVALDRLVASQLN*********************************************DLW*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NAC domain-containing protein 12	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulates the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46.	probable	Q9LPI7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ULX, chain A
Confidence level:very confident
Coverage over the Query: 9-141,163-187
View the alignment between query and template
View the model in PyMOL