Citrus Sinensis ID: 014312


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------
MDPTSRPAVVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSRSSSKANWLAQYNAGVMADLDFFIGDEAVTKSRSSSTYNLSYPIRHGQVDNWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTAPESREYTGEIMFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATYVVPVAEGYVIGSSIKSIPIAGKDVTLFIQQLMRERGENVPPEDSFEVARKVKEMYCYTCSDIVKEYNKHDKEPSKYLKQWRGIKPKTGAPYSCDIGYERFLGPEVFFNPEIYSSDFTTPLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFHRRLQRDLKKIVDARVLASDARLGGEVKAQPVEVNVVSHAIQRYAVWFGGSVLASTPEFFAACHTKAEYEEYGASICRSNPVFKGMY
cccccccEEEEEcccccccccccccccccCEEcccEEEccccccccccccccccccccccccccccccCCcHHHHccccccccEEEccccccccccccHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHccccccEEEHHHHHHHHHHHccccccccccEEEEEcccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHccEEEEccccccccHHHHHHHHHHHHHccccHHHcccccccccccccEEEEEcccccccEEEEcccccccccccccEEEEHHHHHHccccEEEEcccccccc
****SRPAVVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQ*****KANWLAQYNAGVMADLDFFIGDEAVTKSRSSSTYNLSYPIRHGQVDNWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTAPESREYTGEIMFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATYVVPVAEGYVIGSSIKSIPIAGKDVTLFIQQLMRERGENVPPEDSFEVARKVKEMYCYTCSDIVKEYNKHDKEPSKYLKQWRGIKPKTGAPYSCDIGYERFLGPEVFFNPEIYSSDFTTPLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFHRRLQRDLKKIVDARVLASDARLGGEVKAQPVEVNVVSHAIQRYAVWFGGSVLASTPEFFAACHTKAEYEEYGASICRSNPVFK*MY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPTSRPAVVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSRSSSKANWLAQYNAGVMADLDFFIGDEAVTKSRSSSTYNLSYPIRHGQVDNWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTAPESREYTGEIMFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATYVVPVAEGYVIGSSIKSIPIAGKDVTLFIQQLMRERGENVPPEDSFEVARKVKEMYCYTCSDIVKEYNKHDKEPSKYLKQWRGIKPKTGAPYSCDIGYERFLGPEVFFNPEIYSSDFTTPLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFHRRLQRDLKKIVDARVLASDARLGGEVKAQPVEVNVVSHAIQRYAVWFGGSVLASTPEFFAACHTKAEYEEYGASICRSNPVFKGMY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament (By similarity). Involved in the control of cell morphogenesis in leaf epidermal pavement cells, root hairs, hypocotyls epidermal cells and trichomes, especially during rapid cell expansion. Regulates the directionality of cell expansion by regulating the actin organization, and thus the microtubules distribution and the fusion of small vacuoles.confidentQ9SAF1
Actin-related protein 3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. Regulates the directionality of cell expansion by regulating the actin organization, and thus the microtubules distribution and the fusion of small vacuoles.confidentQ6K908
Actin-related protein 3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. The Arp2/3 complex is involved in organizing the actin system in cell motility and chemotaxis, in phagocytosis and macropinocytosis, at late steps of endosome processing, and in mitosis. In concert with a group of other proteins, the Arp2/3 complex plays a general role in the rapid activation and adaptation of the actin system to its multiple functions.probableP42528

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DWL, chain A
Confidence level:very confident
Coverage over the Query: 4-39,63-218,230-267,278-355,371-422
View the alignment between query and template
View the model in PyMOL