Citrus Sinensis ID: 014385

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----

MTNSERKRLNGEAEEEEEDEDDNLNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG

ccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHccccccHHHHHcccEEEEEEEEEccHHHHcccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEEcccccHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHHccEEEEEEEccccHHHHHHHHccccccEEEEccHHHHHHHHHHcccccHHHHHHcccccEEEcccccccccccccEEcccccccccEEEccccccccccccccccccccEEEcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHcccccccccccccccccccccc

cccccccccccccccccccccccccccccccHccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHEEEEEEEEcHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHccccccccccccccHHEccccccccccccEEEEEcccccccccEEccccccEEEEcccccccccEEEEEcHHHHHHHHHccccccccEccHHHccccccccccEEEcccccccccccccccEEEccccccEEEEcccEEHHHHHccccccccccccccEEEccc

mtnserkrlngeaeeeeededdnlnggLEAWERSyaddrswealqedesgflrpidnsafYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRaaaemdfrpsrMAVVAKQVEAFVREffdqnplsqiglvtvKDGVANcltdlggspesHIKALMGklgcsgdssLQNALDLVQGLLsqipsyghrEVLILYSalstcdpgdiMETIQKCKESKIRCSVIGLSAEMFICKHlcqdtggsysvaldeSHFKELimehappppaIAEFAIANLIkmgfpqragegsisicschkevkvgvgytcprckarvcelptdcricglqlvssphlarsyhhlfpiapfdevtplclndprnrsrstcfgcqqsllssgnkpglyvacpkckkhfclECDIYIheslhncpgceslrhsnpivaneg

mtnserkrlngeaeeeeededdnlngGLEAWERSYADDRSWEALQEDesgflrpidnsaFYHAQYrrrlrdrslvatTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHncpgceslrhsnpivaneg

MTNSERKRlngeaeeeeededdnlnggleAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHappppaiaefaiaNLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG

*************************************************GFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCE*************

*******************************ERSYADDRSWEALQEDESGFLRPIDNSAFYHA*********************LIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPE*H**************SLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPA***FAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTP**********RSTCFGCQQSL*********YVACPKCKKHFCLECDIYIHESLHNCPGCESLR**********

***********************LNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG

***********************************ADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNP******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		425	2.2.26 [Sep-21-2011]
Q86KZ2		461	General transcription fac	yes	no	0.931	0.859	0.413	2e-92
Q2TBV5		395	General transcription fac	yes	no	0.851	0.916	0.426	5e-87
A0JN27		396	General transcription fac	yes	no	0.849	0.911	0.424	2e-86
O74995		421	TFIIH basal transcription	yes	no	0.927	0.935	0.412	3e-86
Q13888		395	General transcription fac	yes	no	0.851	0.916	0.431	1e-83
Q6P1K8		395	General transcription fac	yes	no	0.851	0.916	0.431	2e-83
Q9JIB4		396	General transcription fac	yes	no	0.849	0.911	0.416	2e-82
Q04673		461	Suppressor of stem-loop p	yes	no	0.88	0.811	0.418	5e-81
P34567		376	General transcription fac	yes	no	0.868	0.981	0.397	2e-71

>sp\|Q86KZ2\|TF2H2_DICDI General transcription factor IIH subunit 2 OS=Dictyostelium discoideum GN=gtf2h2 PE=3 SV=2	Back alignment and function desciption

 Score =  340 bits (871), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 175/423 (41%), Positives = 259/423 (61%), Gaps = 27/423 (6%)

Query: 2   TNSERKRLN--------GEAEEEEEDEDDNLNGGLEAWERSYADDRSWEALQEDESGFLR 53
            N++ KR N        G A   + +++D  N     WE  +  +++W  + EDE G LR
Sbjct: 8   NNAQNKRTNRSLYDDEDGPAHVLQTNDEDGTNKY--KWENRF--EKTWLTIDEDEHG-LR 62

Query: 54  PIDNSAFYHAQYRRRLRDRS-LVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVV 112
           P +         R + +DR  +++   R+++G+ R+L +++DLS+  +  D +PSR  V+
Sbjct: 63  PSNQEERNTRNRRLKNKDRDGILSQDQRVRRGMQRHLCLILDLSKTLSNQDLKPSRYQVL 122

Query: 113 AKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQ 172
            + VE F++EFFDQNP+SQ+ ++  K+  A  +++L G+   HI+A+   +   G+ S+Q
Sbjct: 123 LQNVELFIKEFFDQNPISQLSIIITKNSKAEKISELSGNRLRHIQAMKDAIAMEGEPSIQ 182

Query: 173 NALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMF 232
           N+L++    L  +P YG REVL ++S+L+TCDP  + +TIQ  K   IR S I ++AE++
Sbjct: 183 NSLEVALSSLCYVPKYGSREVLFIFSSLTTCDPSSLQKTIQSLKNESIRVSFIHMAAELY 242

Query: 233 ICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISI 292
           ICK + + T G+  V L+E HF E +M    PPP I +   A L++MGFPQ+      S 
Sbjct: 243 ICKAIAEQTNGTSKVILNEEHFNESLMLKCQPPPTIGKTEAA-LVEMGFPQQITSTVPSP 301

Query: 293 CSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTP 352
           C CH+++K   GY CPRC  + CELPTDC+IC L LVSSPHLARSYHHLF I  F+EV  
Sbjct: 302 CICHEKMKYS-GYICPRCGVKSCELPTDCQICNLSLVSSPHLARSYHHLFQIPLFNEVNW 360

Query: 353 LCLNDPRNRSRSTCFGCQQSLLSSGNKP--GLYVACPKCKKHFCLECDIYIHESLHNCPG 410
             LN        TC GC    LSS  K    L+ +CP+C++ FCL+CD++IHESLHNCPG
Sbjct: 361 KELN-----KNVTCIGC----LSSSEKSILSLFFSCPRCQEIFCLDCDLFIHESLHNCPG 411

Query: 411 CES 413
           CE+
Sbjct: 412 CEN 414

Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Dictyostelium discoideum (taxid: 44689)

>sp\|Q2TBV5\|TF2H2_BOVIN General transcription factor IIH subunit 2 OS=Bos taurus GN=GTF2H2 PE=2 SV=1	Back alignment and function description

>sp\|A0JN27\|TF2H2_RAT General transcription factor IIH subunit 2 OS=Rattus norvegicus GN=Gtf2h2 PE=2 SV=1	Back alignment and function description

>sp\|O74995\|TFH47_SCHPO TFIIH basal transcription factor complex p47 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfh47 PE=1 SV=1	Back alignment and function description

>sp\|Q13888\|TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens GN=GTF2H2 PE=1 SV=1	Back alignment and function description

>sp\|Q6P1K8\|T2H2L_HUMAN General transcription factor IIH subunit 2-like protein OS=Homo sapiens GN=GTF2H2C PE=2 SV=1	Back alignment and function description

>sp\|Q9JIB4\|TF2H2_MOUSE General transcription factor IIH subunit 2 OS=Mus musculus GN=Gtf2h2 PE=1 SV=1	Back alignment and function description

>sp\|Q04673\|SSL1_YEAST Suppressor of stem-loop protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL1 PE=1 SV=1	Back alignment and function description

>sp\|P34567\|TF2H2_CAEEL General transcription factor IIH subunit 2 OS=Caenorhabditis elegans GN=T16H12.4 PE=3 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		425
297746227		494	unnamed protein product [Vitis vinifera]	0.941	0.809	0.827	0.0
225435253		433	PREDICTED: general transcription factor	0.941	0.923	0.827	0.0
449451946		423	PREDICTED: general transcription factor	0.990	0.995	0.779	0.0
357509341		426	General transcription factor IIH subunit	0.985	0.983	0.762	0.0
224119296		412	predicted protein [Populus trichocarpa]	0.910	0.939	0.827	0.0
356571915		420	PREDICTED: general transcription factor	0.934	0.945	0.795	0.0
297848764		421	ATGTF2H2/GTF2H2 [Arabidopsis lyrata subs	0.912	0.921	0.799	0.0
356538258		419	PREDICTED: general transcription factor	0.92	0.933	0.783	0.0
30679101		421	transcription initiation factor TFIIH su	0.912	0.921	0.796	0.0
357164610		428	PREDICTED: general transcription factor	0.901	0.894	0.755	1e-175

>gi\|297746227\|emb\|CBI16283.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/401 (82%), Positives = 361/401 (90%), Gaps = 1/401 (0%)

Query: 25  NG-GLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQK 83
           NG GL+AWER+YAD+RSWE+LQEDESG LRPIDN   YHAQYRRR+R      TTARIQK
Sbjct: 93  NGRGLDAWERAYADERSWESLQEDESGLLRPIDNKTIYHAQYRRRIRSLYSSTTTARIQK 152

Query: 84  GLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVAN 143
           GLIRYLYIV+DLSRAA+EMDF+PSRMAVVAK +EAF+REFFDQNPLSQIGLVT+KDG+A 
Sbjct: 153 GLIRYLYIVVDLSRAASEMDFKPSRMAVVAKHIEAFIREFFDQNPLSQIGLVTIKDGLAQ 212

Query: 144 CLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTC 203
           CLTDLGGSP+SH+KALMGKL CSGDSSLQNALDLV G L+QIPSYGHREVLILYSALSTC
Sbjct: 213 CLTDLGGSPDSHVKALMGKLECSGDSSLQNALDLVHGYLNQIPSYGHREVLILYSALSTC 272

Query: 204 DPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAP 263
           DPGDIMETIQ+CK+SKIRCSVIGLSAE+FIC+HLCQ+TGGSYSVALDESHFKEL++EHAP
Sbjct: 273 DPGDIMETIQECKKSKIRCSVIGLSAEIFICRHLCQETGGSYSVALDESHFKELLLEHAP 332

Query: 264 PPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRI 323
           PPPAIAEFAIANLIKMGFPQRA EG ISICSCHKE KVG GYTCPRCKARVCELPT+CRI
Sbjct: 333 PPPAIAEFAIANLIKMGFPQRAAEGVISICSCHKEAKVGGGYTCPRCKARVCELPTECRI 392

Query: 324 CGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLY 383
           CGL LVSSPHLARSYHHLFPI PFDEV+   LN+P  RS   CFGCQ+SLL  GNKP L 
Sbjct: 393 CGLTLVSSPHLARSYHHLFPIPPFDEVSLSLLNNPHQRSSRACFGCQESLLIPGNKPTLC 452

Query: 384 VACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANE 424
           VACPKCK+HFCL+CDIYIHESLHNCPGCES RHS  +   E
Sbjct: 453 VACPKCKQHFCLDCDIYIHESLHNCPGCESFRHSKIVSVTE 493

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225435253\|ref\|XP_002284994.1\| PREDICTED: general transcription factor IIH subunit 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449451946\|ref\|XP_004143721.1\| PREDICTED: general transcription factor IIH subunit 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357509341\|ref\|XP_003624959.1\| General transcription factor IIH subunit [Medicago truncatula] gi\|355499974\|gb\|AES81177.1\| General transcription factor IIH subunit [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224119296\|ref\|XP_002331276.1\| predicted protein [Populus trichocarpa] gi\|222873701\|gb\|EEF10832.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356571915\|ref\|XP_003554116.1\| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|297848764\|ref\|XP_002892263.1\| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata] gi\|297338105\|gb\|EFH68522.1\| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356538258\|ref\|XP_003537621.1\| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max]	Back alignment and taxonomy information

>gi|30679101|ref|NP_683275.2| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana] gi|22087278|gb|AAM90909.1|AF499443_1 p44/SSL1-like protein [Arabidopsis thaliana] gi|4056421|gb|AAC97995.1| Similar to gb|Z30094 basic transcripion factor 2, 44 kD subunit from Homo sapiens. EST gb|W43325 comes from this gene [Arabidopsis thaliana] gi|110738828|dbj|BAF01337.1| putative transcription factor [Arabidopsis thaliana] gi|332189663|gb|AEE27784.1| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|357164610\|ref\|XP_003580110.1\| PREDICTED: general transcription factor IIH subunit 2-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		425
TAIR\|locus:504956103		421	GTF2H2 "general transcription	0.917	0.926	0.757	1.5e-163
DICTYBASE\|DDB_G0272362		461	gtf2h2 "TFIIH subunit" [Dictyo	0.877	0.809	0.424	9.1e-84
UNIPROTKB\|E2R345		395	GTF2H2 "Uncharacterized protei	0.851	0.916	0.426	9.4e-82
UNIPROTKB\|I3LKI8		395	GTF2H2 "Uncharacterized protei	0.851	0.916	0.418	6.6e-81
UNIPROTKB\|Q13888		395	GTF2H2 "General transcription	0.851	0.916	0.423	1.8e-80
UNIPROTKB\|Q6P1K8		395	GTF2H2C "General transcription	0.851	0.916	0.423	1.8e-80
ZFIN\|ZDB-GENE-030131-1959		392	gtf2h2 "general transcription	0.849	0.920	0.432	2.2e-80
UNIPROTKB\|G3X7P1		395	GTF2H2 "General transcription	0.851	0.916	0.418	2.9e-80
UNIPROTKB\|Q2TBV5		395	GTF2H2 "General transcription	0.851	0.916	0.418	2.9e-80
POMBASE\|SPCC1682.07		421	ssl1 "transcription factor TFI	0.865	0.874	0.414	3.7e-80

TAIR\|locus:504956103 GTF2H2 "general transcription factor II H2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1592 (565.5 bits), Expect = 1.5e-163, P = 1.5e-163
 Identities = 296/391 (75%), Positives = 328/391 (83%)

Query:    31 WERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLY 90
             WER+Y DDRSWE LQEDESG LRPIDNSA YHAQYRRRLR  S  A   RIQKGLIRYLY
Sbjct:    26 WERAYVDDRSWEELQEDESGLLRPIDNSAIYHAQYRRRLRMLSAAAAGTRIQKGLIRYLY 85

Query:    91 IVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGG 150
             IVID SRAAAEMDFRPSRMA++AK VEAF+REFFDQNPLSQIGLV++K+GVA+ LTDLGG
Sbjct:    86 IVIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGG 145

Query:   151 SPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIME 210
             SPE+HIKALMGKL   GDSSLQNAL+LV   L+Q+PSYGHREVLILYSAL TCDPGDIME
Sbjct:   146 SPETHIKALMGKLEALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIME 205

Query:   211 TIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHXXXXXXXXX 270
             TIQKCK+SK+RCSVIGLSAEMFICKHLCQ+TGG YSVA+DE H K+L++EH         
Sbjct:   206 TIQKCKKSKLRCSVIGLSAEMFICKHLCQETGGLYSVAVDEVHLKDLLLEHAPPPPAIAE 265

Query:   271 XXXXNLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVS 330
                 NLIKMGFPQRA EGS++ICSCHKEVK+G GY CPRCKARVC+LPT+C ICGL LVS
Sbjct:   266 FAIANLIKMGFPQRAAEGSMAICSCHKEVKIGAGYMCPRCKARVCDLPTECTICGLTLVS 325

Query:   331 SPHLARSYHHLFPIAPFDEVTPLC-LNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKC 389
             SPHLARSYHHLFPIAPFDEV  L  LND R +   +CFGCQQSL+ +GNKP   V C KC
Sbjct:   326 SPHLARSYHHLFPIAPFDEVPALSSLNDNRRKLGKSCFGCQQSLIGAGNKPVPCVTCRKC 385

Query:   390 KKHFCLECDIYIHESLHNCPGCESLRHSNPI 420
             K +FCL+CDIYIHESLHNCPGCES+     +
Sbjct:   386 KHYFCLDCDIYIHESLHNCPGCESIHRPKSV 416

GO:0005634 "nucleus" evidence=ISM;IEA

GO:0006281 "DNA repair" evidence=IEA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0005675 "holo TFIIH complex" evidence=IGI

GO:0006289 "nucleotide-excision repair" evidence=IGI

GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IGI

GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA

GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA

DICTYBASE\|DDB_G0272362 gtf2h2 "TFIIH subunit" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R345 GTF2H2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LKI8 GTF2H2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q13888 GTF2H2 "General transcription factor IIH subunit 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6P1K8 GTF2H2C "General transcription factor IIH subunit 2-like protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-1959 gtf2h2 "general transcription factor IIH, polypeptide 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X7P1 GTF2H2 "General transcription factor IIH subunit 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2TBV5 GTF2H2 "General transcription factor IIH subunit 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

POMBASE\|SPCC1682.07 ssl1 "transcription factor TFIIH complex subunit Ssl1" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P34567	TF2H2_CAEEL	No assigned EC number	0.3979	0.8682	0.9813	yes	no
Q86KZ2	TF2H2_DICDI	No assigned EC number	0.4137	0.9317	0.8590	yes	no
Q9JIB4	TF2H2_MOUSE	No assigned EC number	0.4166	0.8494	0.9116	yes	no
O74995	TFH47_SCHPO	No assigned EC number	0.4123	0.9270	0.9358	yes	no
Q04673	SSL1_YEAST	No assigned EC number	0.4189	0.88	0.8112	yes	no
Q6P1K8	T2H2L_HUMAN	No assigned EC number	0.4314	0.8517	0.9164	yes	no
A0JN27	TF2H2_RAT	No assigned EC number	0.4242	0.8494	0.9116	yes	no
Q13888	TF2H2_HUMAN	No assigned EC number	0.4314	0.8517	0.9164	yes	no
Q2TBV5	TF2H2_BOVIN	No assigned EC number	0.4263	0.8517	0.9164	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		425
COG5151		421	COG5151, SSL1, RNA polymerase II transcription ini	1e-119
pfam04056		193	pfam04056, Ssl1, Ssl1-like	1e-109
cd01453		183	cd01453, vWA_transcription_factor_IIH_type, Transc	1e-101
TIGR00622		112	TIGR00622, ssl1, transcription factor ssl1	7e-37
pfam07975		48	pfam07975, C1_4, TFIIH C1-like domain	4e-20
smart01047		49	smart01047, C1_4, TFIIH C1-like domain	8e-17
smart00327		175	smart00327, VWA, von Willebrand factor (vWF) type	4e-16
cd00198		161	cd00198, vWFA, Von Willebrand factor type A (vWA)	6e-11
pfam13519		172	pfam13519, VWA_2, von Willebrand factor type A dom	8e-11
COG5242		296	COG5242, TFB4, RNA polymerase II transcription ini	0.003

>gnl\|CDD\|227480 COG5151, SSL1, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

 Score =  354 bits (909), Expect = e-119
 Identities = 174/423 (41%), Positives = 238/423 (56%), Gaps = 28/423 (6%)

Query: 2   TNSERKRLNGEAEEEEEDEDDNLNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFY 61
           + SE ++ NG  +      DD +N G  +WE+ Y   RSW+ + +D+ G L  +    F 
Sbjct: 13  SESEDEQKNGRVKVRSRKTDD-MNKGY-SWEQEY--KRSWDDVNDDKEGSLVGVVAE-FN 67

Query: 62  HAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVR 121
                    +R     T  +Q+G+IR+L++++D+S A  E DF P+R A V K  E FV 
Sbjct: 68  LETKAPYSNNR-----TTPLQRGIIRHLHLILDVSEAMDESDFLPTRRANVIKYAEGFVP 122

Query: 122 EFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGL 181
           EFF QNP+SQ+ +++++DG A   + + G+P++HI  L  K  CSG+ SLQNAL++ +  
Sbjct: 123 EFFSQNPISQLSIISIRDGCAKYTSSMDGNPQAHIGQLKSKRDCSGNFSLQNALEMARIE 182

Query: 182 LSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDT 241
           L +   +G REVLI++ + ST DPGDI ETI K     IR   IGL AE+ ICK +C+ T
Sbjct: 183 LMKNTMHGTREVLIIFGSTSTRDPGDIAETIDKLVAYNIRVHFIGLCAEVAICKEICKAT 242

Query: 242 G----GSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHK 297
                G Y V +DE H  EL+ E + P          +L+KMGFP    E   S+C+CH 
Sbjct: 243 NSSTEGRYYVPVDEGHLSELMRELSHPTDFNGTKTDLSLVKMGFPSPMMEQLPSVCACHS 302

Query: 298 EVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLND 357
           EVK G GY CP CK +VC LP  C IC LQL+ S HLARSYHHL+P+ PF E       +
Sbjct: 303 EVKGG-GYECPVCKTKVCSLPISCPICSLQLILSTHLARSYHHLYPLKPFVEKP-----E 356

Query: 358 PRNRSRSTCFGCQQSLLSSGNKP-------GLYVACPKCKKHFCLECDIYIHESLHNCPG 410
             N   + CF CQ         P       G Y  C  CK  FC +CD++IHE+LH C G
Sbjct: 357 GTNPKSTHCFVCQGPFPKPPVSPFDESTSSGRY-QCELCKSTFCSDCDVFIHETLHFCIG 415

Query: 411 CES 413
           CE 
Sbjct: 416 CEL 418

Length = 421

>gnl\|CDD\|190848 pfam04056, Ssl1, Ssl1-like	Back alignment and domain information

>gnl\|CDD\|238730 cd01453, vWA_transcription_factor_IIH_type, Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme	Back alignment and domain information

>gnl\|CDD\|129709 TIGR00622, ssl1, transcription factor ssl1	Back alignment and domain information

>gnl\|CDD\|116585 pfam07975, C1_4, TFIIH C1-like domain	Back alignment and domain information

>gnl\|CDD\|214993 smart01047, C1_4, TFIIH C1-like domain	Back alignment and domain information

>gnl\|CDD\|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain	Back alignment and domain information

>gnl\|CDD\|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>gnl\|CDD\|222192 pfam13519, VWA_2, von Willebrand factor type A domain	Back alignment and domain information

>gnl\|CDD\|227567 COG5242, TFB4, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		425
KOG2807		378	consensus RNA polymerase II transcription initiati	100.0
COG5151		421	SSL1 RNA polymerase II transcription initiation/nu	100.0
PF04056		193	Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro	100.0
TIGR00622		112	ssl1 transcription factor ssl1. This family is bas	100.0
TIGR00627		279	tfb4 transcription factor tfb4. This family is bas	100.0
cd01453		183	vWA_transcription_factor_IIH_type Transcription fa	100.0
PF03850		276	Tfb4: Transcription factor Tfb4; InterPro: IPR0046	100.0
KOG2487		314	consensus RNA polymerase II transcription initiati	100.0
cd01452		187	VWA_26S_proteasome_subunit 26S proteasome plays a	100.0
COG5242		296	TFB4 RNA polymerase II transcription initiation/nu	99.96
PRK13685		326	hypothetical protein; Provisional	99.92
cd01467		180	vWA_BatA_type VWA BatA type: Von Willebrand factor	99.85
cd01455		191	vWA_F11C1-5a_type Von Willebrand factor type A (vW	99.85
PF13519		172	VWA_2: von Willebrand factor type A domain; PDB: 3	99.85
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	99.84
TIGR03436		296	acidobact_VWFA VWFA-related Acidobacterial domain.	99.77
cd01456		206	vWA_ywmD_type VWA ywmD type:Von Willebrand factor	99.77
cd01451		178	vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch	99.76
cd01466		155	vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact	99.76
cd01465		170	vWA_subgroup VWA subgroup: Von Willebrand factor t	99.74
TIGR00868		863	hCaCC calcium-activated chloride channel protein 1	99.73
cd01461		171	vWA_interalpha_trypsin_inhibitor vWA_interalpha tr	99.73
cd01472		164	vWA_collagen von Willebrand factor (vWF) type A do	99.73
cd01470		198	vWA_complement_factors Complement factors B and C2	99.71
KOG2884		259	consensus 26S proteasome regulatory complex, subun	99.71
cd01480		186	vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI	99.71
smart00327		177	VWA von Willebrand factor (vWF) type A domain. VWA	99.7
cd01474		185	vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi	99.7
cd01463		190	vWA_VGCC_like VWA Voltage gated Calcium channel li	99.69
cd01477		193	vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand	99.67
cd01469		177	vWA_integrins_alpha_subunit Integrins are a class	99.67
cd01450		161	vWFA_subfamily_ECM Von Willebrand factor type A (v	99.67
cd01460		266	vWA_midasin VWA_Midasin: Midasin is a member of th	99.64
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	99.64
cd00198		161	vWFA Von Willebrand factor type A (vWA) domain was	99.63
COG5148		243	RPN10 26S proteasome regulatory complex, subunit R	99.62
cd01471		186	vWA_micronemal_protein Micronemal proteins: The To	99.61
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	99.6
cd01482		164	vWA_collagen_alphaI-XII-like Collagen: The extrace	99.59
PTZ00441		576	sporozoite surface protein 2 (SSP2); Provisional	99.56
PF00092		178	VWA: von Willebrand factor type A domain; InterPro	99.55
cd01473		192	vWA_CTRP CTRP for CS protein-TRAP-related protein:	99.54
cd01458		218	vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter	99.5
TIGR03788		596	marine_srt_targ marine proteobacterial sortase tar	99.5
PF13768		155	VWA_3: von Willebrand factor type A domain	99.5
cd01476		163	VWA_integrin_invertebrates VWA_integrin (invertebr	99.5
cd01464		176	vWA_subfamily VWA subfamily: Von Willebrand factor	99.47
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.46
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.45
COG1240		261	ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis	99.42
cd01454		174	vWA_norD_type norD type: Denitrifying bacteria con	99.42
cd01481		165	vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V	99.37
cd01462		152	VWA_YIEM_type VWA YIEM type: Von Willebrand factor	99.36
cd01457		199	vWA_ORF176_type VWA ORF176 type: Von Willebrand fa	99.34
PF03731		224	Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte	98.6
PF10138		200	vWA-TerF-like: vWA found in TerF C terminus ; Inte	98.57
COG4245		207	TerY Uncharacterized protein encoded in toxicity p	98.55
cd01479		244	Sec24-like Sec24-like: Protein and membrane traffi	98.41
cd01468		239	trunk_domain trunk domain. COPII-coated vesicles c	98.35
PF05762		222	VWA_CoxE: VWA domain containing CoxE-like protein;	98.33
PRK10997		487	yieM hypothetical protein; Provisional	98.28
PF04811		243	Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I	98.26
TIGR00578		584	ku70 ATP-dependent DNA helicase ii, 70 kDa subunit	98.15
COG2425		437	Uncharacterized protein containing a von Willebran	98.12
COG4867		652	Uncharacterized protein with a von Willebrand fact	98.04
smart00187		423	INB Integrin beta subunits (N-terminal portion of	98.02
PF06707		205	DUF1194: Protein of unknown function (DUF1194); In	97.9
cd01478		267	Sec23-like Sec23-like: Protein and membrane traffi	97.86
PLN00162		761	transport protein sec23; Provisional	97.54
PTZ00395		1560	Sec24-related protein; Provisional	97.22
PF11265		226	Med25_VWA: Mediator complex subunit 25 von Willebr	96.93
PF00362		426	Integrin_beta: Integrin, beta chain; InterPro: IPR	96.89
KOG2353		1104	consensus L-type voltage-dependent Ca2+ channel, a	96.88
COG2304		399	Uncharacterized protein containing a von Willebran	96.86
cd01459		254	vWA_copine_like VWA Copine: Copines are phospholip	96.51
KOG1984		1007	consensus Vesicle coat complex COPII, subunit SFB3	96.48
KOG3768		888	consensus DEAD box RNA helicase [General function	96.31
PF09967		126	DUF2201: VWA-like domain (DUF2201); InterPro: IPR0	95.96
KOG1985		887	consensus Vesicle coat complex COPII, subunit SEC2	95.91
COG5028		861	Vesicle coat complex COPII, subunit SEC24/subunit	95.55
KOG1986		745	consensus Vesicle coat complex COPII, subunit SEC2	95.08
COG1721		416	Uncharacterized conserved protein (some members co	94.72
PF07002		146	Copine: Copine; InterPro: IPR010734 This represent	94.65
COG4548		637	NorD Nitric oxide reductase activation protein [In	94.5
KOG2326		669	consensus DNA-binding subunit of a DNA-dependent p	94.44
TIGR01651		600	CobT cobaltochelatase, CobT subunit. This model de	94.26
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	94.14
PF11775		219	CobT_C: Cobalamin biosynthesis protein CobT VWA do	93.55
COG3552		395	CoxE Protein containing von Willebrand factor type	93.43
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	91.57
PRK04023		1121	DNA polymerase II large subunit; Validated	91.29
PF01363		69	FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f	90.82
KOG1226		783	consensus Integrin beta subunit (N-terminal portio	90.08
smart00064		68	FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	89.8
TIGR00373		158	conserved hypothetical protein TIGR00373. This fam	89.8
KOG1327		529	consensus Copine [Signal transduction mechanisms]	88.81
PRK06266		178	transcription initiation factor E subunit alpha; V	88.51
cd00729		34	rubredoxin_SM Rubredoxin, Small Modular nonheme ir	88.01
cd00065		57	FYVE FYVE domain; Zinc-binding domain; targets pro	86.02
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	84.48
cd00350		33	rubredoxin_like Rubredoxin_like; nonheme iron bind	83.66
PF03833		900	PolC_DP2: DNA polymerase II large subunit DP2; Int	83.22
PRK14890		59	putative Zn-ribbon RNA-binding protein; Provisiona	83.08
PF07754		24	DUF1610: Domain of unknown function (DUF1610); Int	83.02
PF09723		42	Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134	82.76
TIGR02300		129	FYDLN_acid conserved hypothetical protein TIGR0230	82.56
smart00531		147	TFIIE Transcription initiation factor IIE.	82.39
PRK00398		46	rpoP DNA-directed RNA polymerase subunit P; Provis	81.78
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	80.7
PF01485		64	IBR: IBR domain; InterPro: IPR002867 Zinc finger (	80.31

>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]	Back alignment and domain information

Probab=100.00  E-value=2.8e-123  Score=899.99  Aligned_cols=371  Identities=59%  Similarity=1.031  Sum_probs=352.6

Q ss_pred             cccccccccccccccccccceecCCCccccccchhHHHHHhHhhhhccccccchhhhhhccccceEEEEEeCCHhhhhCC
Q 014385           24 LNGGLEAWERSYADDRSWEALQEDESGFLRPIDNSAFYHAQYRRRLRDRSLVATTARIQKGLIRYLYIVIDLSRAAAEMD  103 (425)
Q Consensus        24 ~~~g~~~We~~y~~~~sW~~l~ed~~g~l~~~~~~~~~~~kr~~~~~~~~~~~~~~~~rrGiiR~lvlvLD~S~SM~a~D  103 (425)
                      ..+| |+||++|  +||||.|+||++|+|..+++++++.+||||+++      ..++.|+|||||++||||.|++|.++|
T Consensus         7 ~~~~-y~WE~eY--~RsWe~l~ede~Gsl~~~ia~~v~~~krk~~~~------~~t~~r~GiiRhl~iviD~S~am~e~D   77 (378)
T KOG2807|consen    7 MNKG-YTWEGEY--KRSWEILKEDESGSLEKSIASIVNEAKRKRRLR------YSTRIRKGIIRHLYIVIDCSRAMEEKD   77 (378)
T ss_pred             hccc-cchhhhh--hhhHHHhhcccccchHHHHHHHHHHHHHhhhhh------ccchhhhhhheeEEEEEEhhhhhhhcc
Confidence            3455 8999999  999999999999999999999999999999985      668999999999999999999999999


Q ss_pred             CCCChHHHHHHHHHHHHHHHhhcCCCCcEEEEeecCCceEEeeCCCCCHHHHHHHHhhhhCCCCcchHHHHHHHHHHHHh
Q 014385          104 FRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLS  183 (425)
Q Consensus       104 ~~P~RL~~a~~~l~~Fv~~~~~qnp~sqlGvI~~~~g~A~~lsplT~d~~~~i~~L~~~~~~~G~tsL~nAL~~A~~~L~  183 (425)
                      ++|+|+..+.++++.||.+||+|||++|||||+++||.|++++.+|||++.|+++|+.+.++.|++||||||++|...|+
T Consensus        78 f~P~r~a~~~K~le~Fv~eFFdQNPiSQigii~~k~g~A~~lt~ltgnp~~hI~aL~~~~~~~g~fSLqNaLe~a~~~Lk  157 (378)
T KOG2807|consen   78 FRPSRFANVIKYLEGFVPEFFDQNPISQIGIISIKDGKADRLTDLTGNPRIHIHALKGLTECSGDFSLQNALELAREVLK  157 (378)
T ss_pred             CCchHHHHHHHHHHHHHHHHhccCchhheeEEEEecchhhHHHHhcCCHHHHHHHHhcccccCCChHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999988789999999999999999999


Q ss_pred             CCCCCCCcEEEEEEcCCCCCCccCHHHHHHHHHhCCcEEEEEEecchHHHHHHHHHhhCCeEEEecChhHHHHHHHhcCC
Q 014385          184 QIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAP  263 (425)
Q Consensus       184 ~~p~~~sreILiI~ss~~t~d~~~i~~ti~~akk~~IrV~vIglg~e~~iLk~iA~~TGG~Y~~~~d~~~L~~lL~~~~~  263 (425)
                      ++|+|.+||||||++++.|+|||||+++|+++++.+|||++|||++|+.++|.||++|||.|.|+.|++||++||.+++.
T Consensus       158 ~~p~H~sREVLii~sslsT~DPgdi~~tI~~lk~~kIRvsvIgLsaEv~icK~l~kaT~G~Y~V~lDe~HlkeLl~e~~~  237 (378)
T KOG2807|consen  158 HMPGHVSREVLIIFSSLSTCDPGDIYETIDKLKAYKIRVSVIGLSAEVFICKELCKATGGRYSVALDEGHLKELLLEHTH  237 (378)
T ss_pred             CCCcccceEEEEEEeeecccCcccHHHHHHHHHhhCeEEEEEeechhHHHHHHHHHhhCCeEEEEeCHHHHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccchhhhhhceeeecCCCCCCCCCcceeeecCCccccCeEEcCCCCccccCCCCCCCCCCceecCchhHHhhhcccCC
Q 014385          264 PPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFP  343 (425)
Q Consensus       264 Pp~~~~~~~~~~Li~mGFP~~~~~~~~a~C~CH~~~~~~~Gy~Cp~C~s~~C~lP~~C~~C~l~LvssphLarsyhhlfp  343 (425)
                      |||+.+ ..+.+||+||||++...+.+++|+||..++.. ||.||||++++|+||++||+|+|+||||||||||||||||
T Consensus       238 Pp~~~~-~~~~sLvkmGFP~~~~e~~ps~C~CH~~~~~~-Gy~CP~CkakvCsLP~eCpiC~ltLVss~hLARSyhhL~P  315 (378)
T KOG2807|consen  238 PPPANK-SKECSLVKMGFPSRSPEDTPSFCACHSELSGG-GYFCPQCKAKVCSLPIECPICSLTLVSSPHLARSYHHLFP  315 (378)
T ss_pred             CCCccc-ccCCceEEecCCCcccccCcchheeccccccC-ceeCCcccCeeecCCccCCccceeEecchHHHHHHHhhcC
Confidence            999874 44899999999999999999999999888888 9999999999999999999999999999999999999999


Q ss_pred             CCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhccCCCCCCCCCCC
Q 014385          344 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLR  415 (425)
Q Consensus       344 ~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCD~fiHe~lh~CPgC~~~~  415 (425)
                      |++|.|+++     .+..+++.||+|+..+.     .+.+|+|+.|+++||.|||+||||+||+||||+++.
T Consensus       316 L~~F~Eip~-----~~~~~~~~Cf~C~~~~~-----~~~~y~C~~Ck~~FCldCDv~iHesLh~CpgCeh~~  377 (378)
T KOG2807|consen  316 LKPFVEIPE-----TEYNGSRFCFACQGELL-----SSGRYRCESCKNVFCLDCDVFIHESLHNCPGCEHKP  377 (378)
T ss_pred             Ccchhhccc-----cccCCCcceeeeccccC-----CCCcEEchhccceeeccchHHHHhhhhcCCCcCCCC
Confidence            999999964     56667888999964443     346899999999999999999999999999999643

>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex	Back alignment and domain information

>TIGR00622 ssl1 transcription factor ssl1	Back alignment and domain information

>TIGR00627 tfb4 transcription factor tfb4	Back alignment and domain information

>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme	Back alignment and domain information

>PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>KOG2487 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins	Back alignment and domain information

>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13685 hypothetical protein; Provisional	Back alignment and domain information

>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain	Back alignment and domain information

>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto)	Back alignment and domain information

>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>TIGR00868 hCaCC calcium-activated chloride channel protein 1	Back alignment and domain information

>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin)	Back alignment and domain information

>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins	Back alignment and domain information

>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation	Back alignment and domain information

>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>smart00327 VWA von Willebrand factor (vWF) type A domain	Back alignment and domain information

>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax	Back alignment and domain information

>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta	Back alignment and domain information

>cd01477 vWA_F09G8-8_type VWA F09G8	Back alignment and domain information

>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration	Back alignment and domain information

>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional	Back alignment and domain information

>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma	Back alignment and domain information

>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology	Back alignment and domain information

>cd01458 vWA_ku Ku70/Ku80 N-terminal domain	Back alignment and domain information

>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein	Back alignment and domain information

>PF13768 VWA_3: von Willebrand factor type A domain	Back alignment and domain information

>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions	Back alignment and domain information

>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism]	Back alignment and domain information

>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases	Back alignment and domain information

>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway	Back alignment and domain information

>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts	Back alignment and domain information

>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only]	Back alignment and domain information

>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles	Back alignment and domain information

>cd01468 trunk_domain trunk domain	Back alignment and domain information

>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown	Back alignment and domain information

>PRK10997 yieM hypothetical protein; Provisional	Back alignment and domain information

>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []	Back alignment and domain information

>TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70)	Back alignment and domain information

>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region)	Back alignment and domain information

>PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length	Back alignment and domain information

>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles	Back alignment and domain information

>PLN00162 transport protein sec23; Provisional	Back alignment and domain information

>PTZ00395 Sec24-related protein; Provisional	Back alignment and domain information

>PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells	Back alignment and domain information

>PF00362 Integrin_beta: Integrin, beta chain; InterPro: IPR002369 Integrins are the major metazoan receptors for cell adhesion to extracellular matrix proteins and, in vertebrates, also play important roles in certain cell-cell adhesions, make transmembrane connections to the cytoskeleton and activate many intracellular signalling pathways [, ]	Back alignment and domain information

>KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium	Back alignment and domain information

>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3768 consensus DEAD box RNA helicase [General function prediction only]	Back alignment and domain information

>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function	Back alignment and domain information

>KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only]	Back alignment and domain information

>PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines	Back alignment and domain information

>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2326 consensus DNA-binding subunit of a DNA-dependent protein kinase (Ku80 autoantigen) [Replication, recombination and repair]	Back alignment and domain information

>TIGR01651 CobT cobaltochelatase, CobT subunit	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain	Back alignment and domain information

>COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>PRK04023 DNA polymerase II large subunit; Validated	Back alignment and domain information

>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	Back alignment and domain information

>TIGR00373 conserved hypothetical protein TIGR00373	Back alignment and domain information

>KOG1327 consensus Copine [Signal transduction mechanisms]	Back alignment and domain information

>PRK06266 transcription initiation factor E subunit alpha; Validated	Back alignment and domain information

>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase	Back alignment and domain information

>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center	Back alignment and domain information

>PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus	Back alignment and domain information

>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional	Back alignment and domain information

>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species	Back alignment and domain information

>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria	Back alignment and domain information

>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300	Back alignment and domain information

>smart00531 TFIIE Transcription initiation factor IIE	Back alignment and domain information

>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		425
1z60_A		59	Solution Structure Of The Carboxy-Terminal Domain O		4e-05

>pdb|1Z60|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Human Tfiih P44 Subunit Length = 59

Back alignment and structure

Iteration: 1
 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 5/46 (10%)
Query: 366 CFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGC 411
           C+GCQ  L        +YV C  C+  FC++CD+++H+SLH+CPGC
Sbjct: 18  CYGCQGEL----KDQHVYV-CAVCQNVFCVDCDVFVHDSLHSCPGC 58

PyMOL of 1z60

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		425
2x5n_A		192	SPRPN10, 26S proteasome regulatory subunit RPN10;	2e-42
1z60_A		59	TFIIH basal transcription factor complex P44 subun	1e-18
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-08
3ibs_A		218	Conserved hypothetical protein BATB; structural ge	3e-05

>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192	Back alignment and structure

 Score =  146 bits (370), Expect = 2e-42
 Identities = 34/199 (17%), Positives = 72/199 (36%), Gaps = 13/199 (6%)

Query: 85  LIRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANC 144
           ++    I+ID S      D+ P+R       V     +  + NP +  GL+T+ D     
Sbjct: 1   VLEATMILIDNSEWMINGDYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQV 60

Query: 145 LTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSA-LSTC 203
           L+ L       + A+   L   G++   + + + Q  L    +   R+ ++ +       
Sbjct: 61  LSTLTRDYGKFLSAM-HDLPVRGNAKFGDGIQIAQLALKHRENKIQRQRIVAFVGSPIVE 119

Query: 204 DPGDIMETIQKCKESKIRCSVI--GLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEH 261
           D  +++   ++ K++ +   +I  G        +H       S     D  H   +    
Sbjct: 120 DEKNLIRLAKRMKKNNVAIDIIHIGELQNESALQHFIDAANSS-----DSCHLVSI---- 170

Query: 262 APPPPAIAEFAIANLIKMG 280
            P P  +++    + I  G
Sbjct: 171 PPSPQLLSDLVNQSPIGQG 189

PyMOL of 2x5n

>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Length = 59	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Length = 218	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		425
2x5n_A		192	SPRPN10, 26S proteasome regulatory subunit RPN10;	99.96
4b4t_W		268	RPN10, 26S proteasome regulatory subunit RPN10; hy	99.94
3ibs_A		218	Conserved hypothetical protein BATB; structural ge	99.89
1z60_A		59	TFIIH basal transcription factor complex P44 subun	99.84
1q0p_A		223	Complement factor B; VON willebrand factor, MAC-1,	99.8
1shu_X		182	Anthrax toxin receptor 2; alpha/beta rossmann fold	99.8
2b2x_A		223	Integrin alpha-1; computational design, antibody-a	99.78
1v7p_C		200	Integrin alpha-2; snake venom, C-type lectin, anta	99.77
1ijb_A		202	VON willebrand factor; dinucleotide-binding fold,	99.76
1n3y_A		198	Integrin alpha-X; alpha/beta rossmann fold, cell a	99.76
1pt6_A		213	Integrin alpha-1; cell adhesion; 1.87A {Homo sapie	99.75
1rrk_A		497	Complement factor B; BB, hydrolase; 2.00A {Homo sa	99.74
1atz_A		189	VON willebrand factor; collagen-binding, hemostasi	99.74
1mf7_A		194	Integrin alpha M; cell adhesion; 1.25A {Homo sapie	99.73
3n2n_F		185	Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho	99.73
4fx5_A		464	VON willebrand factor type A; structural genomics,	99.73
4hqf_A		281	Thrombospondin-related anonymous protein, trap; ma	99.73
4hqo_A		266	Sporozoite surface protein 2; malaria, gliding mot	99.73
1jey_B		565	KU80; double-strand DNA break repair, non-homologo	99.71
2x31_A		189	Magnesium-chelatase 60 kDa subunit; ligase, bacter	99.69
2odp_A		509	Complement C2; C3/C5 convertase, complement serin	99.67
3hrz_D		741	Complement factor B; serine protease, glycosilated	99.67
2xgg_A		178	Microneme protein 2; A/I domain, cell adhesion, hy	99.64
3zqk_A		199	VON willebrand factor; blood clotting, adamts-13,	99.56
1mjn_A		179	Integrin alpha-L; rossmann fold, immune system; 1.	99.56
1jey_A		609	KU70; double-strand DNA break repair, non-homologo	99.53
3k6s_A		1095	Integrin alpha-X; cell receptor, adhesion molecule	99.42
1yvr_A		538	RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein,	99.23
2ww8_A		893	RRGA, cell WALL surface anchor family protein; IGG	99.12
2nvo_A		535	RO sixty-related protein, RSR; alpha helical repea	99.03
2iue_A		212	Pactolus I-domain; membrane protein, CD, ITC, limb	98.62
3rag_A		242	Uncharacterized protein; structural genomics, PSI-	98.54
3rag_A		242	Uncharacterized protein; structural genomics, PSI-	98.48
2nut_A		769	Protein transport protein SEC23A; human copii SEC2	98.29
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	98.27
1pcx_A		810	Protein transport protein SEC24; 2.50A {Saccharomy	98.23
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	98.06
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	97.95
1m2o_A		768	SEC23, protein transport protein SEC23, SEC23P; zi	97.91
3vi3_B		454	Integrin beta-1; beta propeller fold, rossman fold	97.86
3t3p_B		472	Integrin beta-3; integrin, cell adhesion, blood cl	97.78
3eh1_A		751	Protein transport protein SEC24B; copii coat prote	97.67
3v4v_B		503	Integrin beta-7; cell adhesion, madcam-1, membrane	97.65
3eh2_A		766	Protein transport protein SEC24C; copii-coat prote	97.43
3efo_B		770	SEC24 related gene family, member D; copii, coat p	97.41
2dlq_A		124	GLI-kruppel family member HKR3; ZF-C2H2 domain, st	92.66
2i13_A		190	AART; DNA binding, zinc finger, DNA binding protei	91.92
2lt7_A		133	Transcriptional regulator kaiso; zinc finger, doub	91.33
2dmd_A		96	Zinc finger protein 64, isoforms 1 and 2; ZNF338,	90.93
1z2q_A		84	LM5-1; membrane protein, FYVE domain, zinc-finger;	90.79
2yw8_A		82	RUN and FYVE domain-containing protein 1; structur	90.61
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	90.37
1x4u_A		84	Zinc finger, FYVE domain containing 27 isoform B;	90.22
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	90.17
2dlq_A		124	GLI-kruppel family member HKR3; ZF-C2H2 domain, st	90.04
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	89.85
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	89.46
2ect_A		78	Ring finger protein 126; metal binding protein, st	89.38
2ee8_A		106	Protein ODD-skipped-related 2; zinc binding, ZF-C2	89.26
1joc_A		125	EEA1, early endosomal autoantigen 1; FYVE domain,	89.18
2i13_A		190	AART; DNA binding, zinc finger, DNA binding protei	89.08
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	88.89
3t7l_A		90	Zinc finger FYVE domain-containing protein 16; str	88.88
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	88.77
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	87.69
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	87.58
6rxn_A		46	Rubredoxin; electron transfer(iron-sulfur protein)	87.58
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	87.49
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	87.48
3pwf_A		170	Rubrerythrin; non heme iron peroxidases, oxidative	86.23
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	85.84
1y02_A		120	CARP2, FYVE-ring finger protein sakura; zinc-bindi	85.47
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	85.31
2kmk_A		82	Zinc finger protein GFI-1; tandem repeat zinc fing	85.2
1vfy_A		73	Phosphatidylinositol-3-phosphate binding FYVE doma	85.12
1wg2_A		64	Zinc finger (AN1-like) family protein; riken struc	85.1
1wfk_A		88	Zinc finger, FYVE domain containing 19; riken stru	85.07
2yt9_A		95	Zinc finger-containing protein 1; C2H2, structural	85.0
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	84.29
1lko_A		191	Rubrerythrin all-iron(II) form; reduced form, DIIR	83.48
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	83.02
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	82.71
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	82.49
3zyq_A		226	Hepatocyte growth factor-regulated tyrosine kinas	82.26
2v3b_B		55	Rubredoxin 2, rubredoxin; alkane degradation, iron	82.24
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	82.11
2jp9_A		119	Wilms tumor 1; DNA binding, nucleic acid recogniti	81.9
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	81.79
2dmi_A		115	Teashirt homolog 3; zinc finger protein 537, struc	81.68
2kn9_A		81	Rubredoxin; metalloprotein, ssgcid, structural gen	81.54
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	80.63
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	80.57
1wff_A		85	Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc	80.55
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	80.42
1wfp_A		74	Zinc finger (AN1-like) family protein; ZF-AN1 doma	80.38
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	80.38
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	80.31

>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe}	Back alignment and structure

Probab=99.96  E-value=1.4e-28  Score=228.75  Aligned_cols=172  Identities=16%  Similarity=0.251  Sum_probs=145.8

Q ss_pred             cceEEEEEeCCHhhhhCCCCCChHHHHHHHHHHHHHHHhhcCCCCcEEEEeecCCceEEeeCCCCCHHHHHHHHhhhhCC
Q 014385           86 IRYLYIVIDLSRAAAEMDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGC  165 (425)
Q Consensus        86 iR~lvlvLD~S~SM~a~D~~P~RL~~a~~~l~~Fv~~~~~qnp~sqlGvI~~~~g~A~~lsplT~d~~~~i~~L~~~~~~  165 (425)
                      ++.+||+||+|.||.+.|+.||||++++..+..|+.+|+++||.+++|||+|+++.|++++|+|.|+..+...|.+ +.+
T Consensus         2 ~e~lvlvlD~S~SM~~~D~~psRl~~ak~~~~~~~~~~~~~~~~d~vGLV~fa~~~a~~~~plT~d~~~i~~~L~~-l~~   80 (192)
T 2x5n_A            2 LEATMILIDNSEWMINGDYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAMHD-LPV   80 (192)
T ss_dssp             CEEEEEEECCSGGGGCTTSSSCHHHHHHHHHHHHHHHHHHHCTTCEEEEEECCTTSCCEEEEEESCHHHHHHHHTT-CCC
T ss_pred             ceEEEEEEECCHhhccCCCCCCHHHHHHHHHHHHHHHHHhcCCCCeEEEEEEcCCCcEEecCCCCCHHHHHHHHHc-CCC
Confidence            4689999999999999999999999999999999999999999999999999744799999999999999999987 578


Q ss_pred             CCcchHHHHHHHHHHHHhCCCCCCCc-EEEEEEcCCCCCCccCHHHHHHHHHhCCcEEEEEEecchH---HHHHHHHHhh
Q 014385          166 SGDSSLQNALDLVQGLLSQIPSYGHR-EVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEM---FICKHLCQDT  241 (425)
Q Consensus       166 ~G~tsL~nAL~~A~~~L~~~p~~~sr-eILiI~ss~~t~d~~~i~~ti~~akk~~IrV~vIglg~e~---~iLk~iA~~T  241 (425)
                      .|+|++++||++|...|++.+.+..+ +|||++++..+.++.++.++++.++++||+|+|||+|++.   . |+++|+.+
T Consensus        81 ~g~t~l~~aL~~A~~~l~~~~~~~~~~riiil~~~~~~~~~~~~~~~a~~lk~~gi~v~~Ig~G~~~~~~~-l~~la~~~  159 (192)
T 2x5n_A           81 RGNAKFGDGIQIAQLALKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVAIDIIHIGELQNESA-LQHFIDAA  159 (192)
T ss_dssp             CSCCCHHHHHHHHHHHHHTCSCTTSEEEEEEEECSCCSSCHHHHHHHHHHHHHTTEEEEEEEESCC---CH-HHHHHHHH
T ss_pred             CCCchHHHHHHHHHHHHHhccccCCCceEEEEEECCCCCCchhHHHHHHHHHHCCCEEEEEEeCCCCccHH-HHHHHHhc
Confidence            88999999999999999997655544 5666665544567888999999999999999999999875   6 99999996


Q ss_pred             C----CeEEEe-cChhHHHHHHH
Q 014385          242 G----GSYSVA-LDESHFKELIM  259 (425)
Q Consensus       242 G----G~Y~~~-~d~~~L~~lL~  259 (425)
                      +    +.|+.. ....-|.+.|.
T Consensus       160 n~~~~s~~~~~~~~~~~l~d~~~  182 (192)
T 2x5n_A          160 NSSDSCHLVSIPPSPQLLSDLVN  182 (192)
T ss_dssp             CSTTCCEEEEECCCSSCHHHHHH
T ss_pred             cCCCceEEEEecCcchhHHHHHh
Confidence            5    355533 33334666554

PyMOL of 2x5n

>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2	Back alignment and structure

>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y*	Back alignment and structure

>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1	Back alignment and structure

>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A	Back alignment and structure

>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C	Back alignment and structure

>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A	Back alignment and structure

>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A	Back alignment and structure

>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A	Back alignment and structure

>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G	Back alignment and structure

>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila}	Back alignment and structure

>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A	Back alignment and structure

>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A*	Back alignment and structure

>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B*	Back alignment and structure

>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus}	Back alignment and structure

>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A*	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F*	Back alignment and structure

>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii}	Back alignment and structure

>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A*	Back alignment and structure

>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ...	Back alignment and structure

>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B	Back alignment and structure

>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A*	Back alignment and structure

>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A	Back alignment and structure

>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}	Back alignment and structure

>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans}	Back alignment and structure

>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus}	Back alignment and structure

>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A*	Back alignment and structure

>3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B*	Back alignment and structure

>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B*	Back alignment and structure

>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B	Back alignment and structure

>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B*	Back alignment and structure

>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens}	Back alignment and structure

>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B	Back alignment and structure

>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C*	Back alignment and structure

>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A*	Back alignment and structure

>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major}	Back alignment and structure

>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1	Back alignment and structure

>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A	Back alignment and structure

>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}	Back alignment and structure

>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1	Back alignment and structure

>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1	Back alignment and structure

>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1	Back alignment and structure

>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A*	Back alignment and structure

>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A*	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		425
d1z60a1		59	g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-ri	4e-18
d1jeyb2		236	c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain	6e-06

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 59	Back information, alignment and structure


class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: TFIIH p44 subunit cysteine-rich domain
domain: TFIIH p44 subunit cysteine-rich domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.6 bits (186), Expect = 4e-18
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 344 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHE 403
           +  F E+     N  R      C+GCQ  L            C  C+  FC++CD+++H+
Sbjct: 1   LDAFQEIPLEEYNGERF-----CYGCQGELKDQH-----VYVCAVCQNVFCVDCDVFVHD 50

Query: 404 SLHNCPGC 411
           SLH+CPGC
Sbjct: 51  SLHSCPGC 58

PyMOL of d1z60a1

>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		425
d1z60a1		59	TFIIH p44 subunit cysteine-rich domain {Human (Hom	99.86
d1jeyb2		236	Ku80 subunit N-terminal domain {Human (Homo sapien	99.69
d1shux_		181	Capillary morphogenesis protein 2 domain {Human (H	99.66
d1jeya2		220	Ku70 subunit N-terminal domain {Human (Homo sapien	99.63
d1q0pa_		209	Complement factor B domain {Human (Homo sapiens) [	99.59
d1v7pc_		193	Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId	99.57
d1atza_		184	von Willebrand factor A3 domain, vWA3 {Human (Homo	99.57
d1pt6a_		192	Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId	99.56
d1ijba_		202	von Willebrand factor A1 domain, vWA1 {Human (Homo	99.5
d1n3ya_		189	Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI	99.5
d1mf7a_		194	Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub	99.48
d1mjna_		179	Integrin CD11a/CD18 (Leukocyte function associated	99.18
d1yvra2		174	60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c	99.04
d1tyeb2		248	Integrin beta A domain {Human (Homo sapiens) [TaxI	99.03
d1pd0a3		252	Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T	98.55
d2qtva3		271	Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T	98.29
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	94.32
d1dvpa2		72	Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7	92.66
d1yuza2		36	Nigerythrin, C-terminal domain {Desulfovibrio vulg	90.98
d1joca1		64	Eea1 {Human (Homo sapiens) [TaxId: 9606]}	90.82
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	90.41
d1wfka_		88	Zinc finger FYVE domain containing protein 19 {Mou	89.99
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	89.86
d1vfya_		67	vps27p protein {Baker's yeast (Saccharomyces cerev	89.22
d1y02a2		51	Rififylin (FYVE-RING finger protein Sakura) {Human	88.44
d1nnqa2		37	Rubrerythrin, C-terminal domain {Archaeon Pyrococc	87.86
d2ct7a1		73	Ring finger protein 31 {Human (Homo sapiens) [TaxI	87.28
d1vd4a_		62	Transcription initiation factor TFIIE-alpha {Human	86.09
d1zbdb_		124	Effector domain of rabphilin-3a {Rat (Rattus norve	85.27
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	83.6
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	82.19

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: TFIIH p44 subunit cysteine-rich domain
domain: TFIIH p44 subunit cysteine-rich domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=1.1e-23  Score=155.91  Aligned_cols=59  Identities=36%  Similarity=0.975  Sum_probs=51.3

Q ss_pred             CCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhccCCCCCCCC
Q 014385          344 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCE  412 (425)
Q Consensus       344 ~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCD~fiHe~lh~CPgC~  412 (425)
                      |++|+||+++     +..+++.||||+++|++     +++|+|++|+++||+|||+||||+|||||||+
T Consensus         1 L~~F~EVp~~-----~~~~~~~C~gC~~~l~~-----~~~y~C~~C~~~FC~dCD~fiHe~lh~CpgCl   59 (59)
T d1z60a1           1 LDAFQEIPLE-----EYNGERFCYGCQGELKD-----QHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI   59 (59)
T ss_dssp             CCSCCEEEHH-----HHCSCCEETTTTEECTT-----SEEECCTTTTCCBCHHHHHTTTTTSCSSSTTC
T ss_pred             CCCcceeehh-----hcCCCCCccCCCCcCCC-----CceEECcCCCCccccccchhhhhhhcCCCCCC
Confidence            6899999763     33457899999999863     36899999999999999999999999999995

PyMOL of d1z60a1

>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure