Citrus Sinensis ID: 014425

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----

MRGNEPNGHRGVRRKDHVVQENGDTDTSSGSDELDPWTAWAYKPRTISFLLIGACFLIWASGALDPQSDSGDVVTSVKRGIWAMIAVFLTYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLVALTFLLFQKRDDARQFMKFLHPDLGVELPERSYGADCRIYVHENPTSRFKNVYETLFDEFVLAHIFGWWGKAILIRNQPLLWLLSIGFELMELTFRHMLPNFNECWWDSIILDILICNWFGIWAGMHTVRYFDGKTYEWVGISRQPNIIGKFKRTLGQFTPAQWDKDEWHPLLGPWRFIQVLTLCIIFLTVELNTFFLKFCLWVPPRNPVIIYRLILWWLIAIPTIREYNSYLQDRKPVKKVGAFCWLSLAICIIELLICIKFGHGLYPNPMPLWLVIFWLCVGFCLIAFLIIWSYKSLERKRR

cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEEEECcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*****************************GSDELDPWTAWAYKPRTISFLLIGACFLIWASGALDPQSDSGDVVTSVKRGIWAMIAVFLTYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLVALTFLLFQKRDDARQFMKFLHPDLGVELPERSYGADCRIYVHENPTSRFKNVYETLFDEFVLAHIFGWWGKAILIRNQPLLWLLSIGFELMELTFRHMLPNFNECWWDSIILDILICNWFGIWAGMHTVRYFDGKTYEWVGISRQPNIIGKFKRTLGQFTPAQWDKDEWHPLLGPWRFIQVLTLCIIFLTVELNTFFLKFCLWVPPRNPVIIYRLILWWLIAIPTIREYNSYLQDRKPVKKVGAFCWLSLAICIIELLICIKFGHGLYPNPMPLWLVIFWLCVGFCLIAFLIIWSYKSLE****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxHxHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phosphatidylserine synthase 2	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine.	probable	B2GV22
Phosphatidylserine synthase 2	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine.	probable	Q08D11
Phosphatidylserine synthase 2	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine.	probable	O08888

Prediction of Enzyme Commission Number

No confident prediction of EC number!