Citrus Sinensis ID: 014433

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MGKDEEEMRGEIEERLINEEYKIWKKNTPFLYDLVITHALEWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENEPNYLMLAQVQLPLDDSENDARHYDDDRSDFGGFGCANGKVQIIQQINHDGEVNRARYMPQNPFLIATKTVSAEVYVFDYSKHPSKPPLDGACSPDLRLRGHSTEGYGLSWSKFKEGHLLSGSDDAQICLWDINAAPKNKSLEAMQIFKVHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRTPSVSKPVQSVVAHQSEVNCLAFNPFNEWILATGSTDKTVKLFDLRKISTALHTFDSHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDEEQTPEDAEDGPPELLFIHGGHTSKISDFSWNPCEDWVISSVAEDNILQIWQMAENIYHDEDDLPGDESAKAS
cccHHHHccccHHcccHHHHHHHHHHccHHHHHHHHHcccccccEEEEECcccccccccccCEEEEEEEECcccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEcccccEEEEEECccccCEEEEECcccEEEEEEcccccccccccccccccEEEEcccccEEEEEEccccccEEEEECccccEEEEEccccccccccccEEEEEEcccEEEEEEEEcccccEEEEECcccEEEEEEcccccccccEEEEccccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEcccccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccccEEEECccccccEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccccccc
**************RLINEEYKIWKKNTPFLYDLVITHALEWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENEPNYLMLAQVQLP****************DFGGFGCANGKVQIIQQINHDGEVNRARYMPQNPFLIATKTVSAEVYVFDYSKHP*********SPDLRLRGHSTEGYGLSWSKFKEGHLLSGSDDAQICLWDINAAPKNKSLEAMQIFKVHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRTPSVSKPVQSVVAHQSEVNCLAFNPFNEWILATGSTDKTVKLFDLRKISTALHTFDSHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDE********DGPPELLFIHGGHTSKISDFSWNPCEDWVISSVAEDNILQIWQMAENIYH**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKDEEEMRGEIEERLINEEYKIWKKNTPFLYDLVITHALEWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENEPNYLMLAQVQLPLDDSENDARHYDDDRSDFGGFGCANGKVQIIQQINHDGEVNRARYMPQNPFLIATKTVSAEVYVFDYSKHPSKPPLDGACSPDLRLRGHSTEGYGLSWSKFKEGHLLSGSDDAQICLWDINAAPKNKSLEAMQIFKVHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRTPSVSKPVQSVVAHQSEVNCLAFNPFNEWILATGSTDKTVKLFDLRKISTALHTFDSHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDEEQTPEDAEDGPPELLFIHGGHTSKISDFSWNPCEDWVISSVAEDNILQIWQMAENIYHDEDDLPGDESAKAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone-binding protein MSI1 Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair, and the fertilization independent seed (FIS) complex, a polycomb group protein complex which is required to maintain the transcriptionally repressive state of homeotic genes throughout development. Required for several aspects of plant development including normal leaf expansion, correct development of flowers, normal endosperm development, repression of parthenogenetic seed development and repression of floral homeotic genes in leaf tissue. Also required for the recruitment of chromosomal DNA into heterochromatic chromocenters.confidentO22467
WD-40 repeat-containing protein MSI1 confidentO22466
Histone-binding protein MSI1 homolog Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism such as the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair.confidentQ10G81

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XYI, chain A
Confidence level:very confident
Coverage over the Query: 7-88,115-411
View the alignment between query and template
View the model in PyMOL