Citrus Sinensis ID: 014446

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----

MEKELNYSANFQGLDYSLDHHHHHHQEELIMKPRIGDTSDDRNNNHGMIDYMINNNPQPRPQIQQQVSSSSSGFCTSNSFDKLSFADVMQFAEFGPKLSINQTNNRVNVPEEETGIIDPVYFLKFPVLNDKLDEDDEHSLMLPQPGGCNENESFKDNDEIRVSDNNSVQQQLRFLEDDVQNNKSVVNNGPEAKNKRKRPRAIKTTEEVESQRMTHIAVERNRRKQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLESQKRRRILGEAAAAPGGGRQMGDSSMAINQQPQTPLFPPPLPFPNDQIKLMDFETGLREETAENKSCLADVEVKLLGLDAMIKILSRRRPGQLIKAIAALEDLQFNILHTNITTIEQTVLYSFNVKVASETRFTADDIASSVQQVFSFIHANSSM

ccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccc

*********NFQGLDYSLDH**H************************MIDYMINN***********************SFDKLSFADVMQFAEFGPKLSINQTNN******EETGIIDPVYFLKFPVLND*********************************************************************************************KQMNEHLRVLRSLMPGSYVQRGDQASIIGGAIEFVRELEQLLQCLE********************************************************L*EETAE*KSCLADVEVKLLGLDAMIKILSRRRPGQLIKAIAALEDLQFNILHTNITTIEQTVLYSFNVKVASETRFTADDIASSVQQVFSFIH*N***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor FAMA	Transcription activator. Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata.	probable	Q56YJ8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HLO, chain A
Confidence level:confident
Coverage over the Query: 209-274
View the alignment between query and template
View the model in PyMOL

Template: 3LOU, chain A
Confidence level:probable
Coverage over the Query: 347-418
View the alignment between query and template
View the model in PyMOL