Citrus Sinensis ID: 014555

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--

MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA

cccccccccHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc

***************************MLYRVL***********VKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLxxxxxxxxxxxxxxxxxxxxxLTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
26S proteasome non-ATPase regulatory subunit 11	Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, RPN6A is required for proteasome assembly.	confident	Q9LP45
26S proteasome non-ATPase regulatory subunit 11	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	probable	Q2KI42
26S proteasome non-ATPase regulatory subunit 11A	Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, psmd11a is required for proteasome assembly.	probable	F6P3G4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain Q
Confidence level:very confident
Coverage over the Query: 4-387
View the alignment between query and template
View the model in PyMOL