Citrus Sinensis ID: 014555

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
cccccccccHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccEccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHcHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHcccHHHHHHHHHHHHHHccEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
msssylpattdSIAQakeasnpsdAISMLYRvlddpsssseaLRVKELAITELSDLLRQENRAQDLCNLLTQlrpffslipkakTAKIVRGIIDAvakipgtsELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAanaiyvppaqqgtidlqsgilhaeEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIIsskaglqyvgpeLDAMKAVADAHSKRSLKLFETALRDFKAqleedpivhrHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAgtldqgvgcliifedpkadaiypaTLETISNMGKVVDSLFVRSAKIMA
MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKevrrlddklllvdidllesklHFSLRnlpkakaaltaartaanaIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYffeafeafNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
*********************************************KELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVR******
***************************MLYRVL***********VKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTS*********DKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGII***AG**YVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI**
********TTDSIAQAKEASNPSDAISMLYRVL********ALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
******PA*T*SIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLxxxxxxxxxxxxxxxxxxxxxLTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query422 2.2.26 [Sep-21-2011]
Q9LP45419 26S proteasome non-ATPase yes no 0.981 0.988 0.874 0.0
Q7KLV9422 26S proteasome non-ATPase yes no 0.995 0.995 0.513 1e-125
F6XBL2422 26S proteasome non-ATPase yes no 0.964 0.964 0.526 1e-120
F6P3G4421 26S proteasome non-ATPase yes no 0.964 0.966 0.514 1e-119
Q8BG32422 26S proteasome non-ATPase yes no 0.964 0.964 0.514 1e-119
F1LMZ8422 26S proteasome non-ATPase yes no 0.964 0.964 0.514 1e-119
O00231422 26S proteasome non-ATPase yes no 0.964 0.964 0.514 1e-119
Q2KI42422 26S proteasome non-ATPase yes no 0.964 0.964 0.514 1e-119
F1QGH9422 26S proteasome non-ATPase no no 0.964 0.964 0.521 1e-118
Q54UB5413 26S proteasome non-ATPase yes no 0.890 0.910 0.517 1e-115
>sp|Q9LP45|PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 OS=Arabidopsis thaliana GN=RPN6A PE=1 SV=1 Back     alignment and function desciption
 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/415 (87%), Positives = 392/415 (94%), Gaps = 1/415 (0%)

Query: 8   ATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLC 67
           ATT++I+ A EA N S+AI++LY+VL+DPSSS EA+R+KE AIT L D L +E R +DL 
Sbjct: 6   ATTETISLALEA-NSSEAITILYQVLEDPSSSPEAIRIKEQAITNLCDRLTEEKRGEDLR 64

Query: 68  NLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQ 127
            LLT+LRPFFSLIPKAKTAKIVRGIIDAVAKIPGT++LQI LCKEMV+WTRAEKRTFLRQ
Sbjct: 65  KLLTKLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTTDLQITLCKEMVEWTRAEKRTFLRQ 124

Query: 128 RVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAK 187
           RVEARLAALLME++EY EAL LL++LVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAK
Sbjct: 125 RVEARLAALLMENKEYVEALALLSTLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAK 184

Query: 188 AALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALEDPRAV 247
           AALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKT YSYFFEAFE+FNAL DPRAV
Sbjct: 185 AALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTGYSYFFEAFESFNALGDPRAV 244

Query: 248 FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRD 307
           FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGP+LDAMKAVADAHSKRSLKLFE ALRD
Sbjct: 245 FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPDLDAMKAVADAHSKRSLKLFENALRD 304

Query: 308 FKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQM 367
           +KAQLE+DPIVHRHLSSLYDTLLEQNLCRLIEP+SRVEIAHIAELI LP+DHVEKKLSQM
Sbjct: 305 YKAQLEDDPIVHRHLSSLYDTLLEQNLCRLIEPFSRVEIAHIAELIGLPLDHVEKKLSQM 364

Query: 368 ILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA 422
           ILDKKFAGTLDQG GCLIIFEDPKADAIY ATLETI+NMGKVVDSL+VRSAKIM+
Sbjct: 365 ILDKKFAGTLDQGAGCLIIFEDPKADAIYSATLETIANMGKVVDSLYVRSAKIMS 419
Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, RPN6A is required for proteasome assembly.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7KLV9|PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster GN=Rpn6 PE=1 SV=1 Back     alignment and function description
>sp|F6XBL2|PSD11_XENTR 26S proteasome non-ATPase regulatory subunit 11 OS=Xenopus tropicalis GN=psmd11 PE=3 SV=2 Back     alignment and function description
>sp|F6P3G4|PS11A_DANRE 26S proteasome non-ATPase regulatory subunit 11A OS=Danio rerio GN=psmd11a PE=2 SV=1 Back     alignment and function description
>sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus GN=Psmd11 PE=1 SV=3 Back     alignment and function description
>sp|F1LMZ8|PSD11_RAT 26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus GN=Psmd11 PE=2 SV=2 Back     alignment and function description
>sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens GN=PSMD11 PE=1 SV=3 Back     alignment and function description
>sp|Q2KI42|PSD11_BOVIN 26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus GN=PSMD11 PE=2 SV=3 Back     alignment and function description
>sp|F1QGH9|PS11B_DANRE 26S proteasome non-ATPase regulatory subunit 11B OS=Danio rerio GN=psmd11b PE=2 SV=1 Back     alignment and function description
>sp|Q54UB5|PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum GN=psmD11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
115458588425 Os04g0444600 [Oryza sativa Japonica Grou 1.0 0.992 0.879 0.0
219884013426 unknown [Zea mays] 1.0 0.990 0.867 0.0
226493054426 LOC100284700 [Zea mays] gi|195644058|gb| 1.0 0.990 0.867 0.0
326490686426 predicted protein [Hordeum vulgare subsp 1.0 0.990 0.869 0.0
224035057426 unknown [Zea mays] gi|414587062|tpg|DAA3 1.0 0.990 0.864 0.0
242086184426 hypothetical protein SORBIDRAFT_08g02084 1.0 0.990 0.867 0.0
225451255422 PREDICTED: 26S proteasome non-ATPase reg 1.0 1.0 0.912 0.0
242073204426 hypothetical protein SORBIDRAFT_06g01778 1.0 0.990 0.857 0.0
212722498426 uncharacterized protein LOC100193485 [Ze 1.0 0.990 0.857 0.0
195620064426 26S proteasome non-ATPase regulatory sub 1.0 0.990 0.855 0.0
>gi|115458588|ref|NP_001052894.1| Os04g0444600 [Oryza sativa Japonica Group] gi|38344536|emb|CAE02442.2| OSJNBa0027P08.4 [Oryza sativa Japonica Group] gi|38344584|emb|CAE02431.2| OSJNBa0058G03.7 [Oryza sativa Japonica Group] gi|113564465|dbj|BAF14808.1| Os04g0444600 [Oryza sativa Japonica Group] gi|125590511|gb|EAZ30861.1| hypothetical protein OsJ_14933 [Oryza sativa Japonica Group] gi|215694007|dbj|BAG89206.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/422 (87%), Positives = 409/422 (96%)

Query: 1   MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQE 60
           M SSYLPATT+SIA+A+EA + S++IS+LYRVL DPSSS+EALR KELAIT L++ L +E
Sbjct: 4   MESSYLPATTESIAKAQEAKDASESISILYRVLQDPSSSAEALRTKELAITNLTNYLTKE 63

Query: 61  NRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAE 120
           NRA++L NLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQI+LCKEMV+WTRAE
Sbjct: 64  NRAEELRNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQISLCKEMVEWTRAE 123

Query: 121 KRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSL 180
           KRTFLRQRVEARLAALL+E++EYTEALTLLT L+KEVRRLDDKLLLVDIDLLESKLHFSL
Sbjct: 124 KRTFLRQRVEARLAALLLENQEYTEALTLLTGLIKEVRRLDDKLLLVDIDLLESKLHFSL 183

Query: 181 RNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNA 240
           RNLPKAKA+LTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAF+A
Sbjct: 184 RNLPKAKASLTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFSA 243

Query: 241 LEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKL 300
           LEDP+A+FSLKYMLLCKIMV+QADDVAGIISSKAGL+Y+GP++DAMKAVADA+SKRSLK 
Sbjct: 244 LEDPKAIFSLKYMLLCKIMVNQADDVAGIISSKAGLKYLGPDVDAMKAVADAYSKRSLKY 303

Query: 301 FETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHV 360
           FETALRD+K+QLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAE+IELP+DHV
Sbjct: 304 FETALRDYKSQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAEMIELPVDHV 363

Query: 361 EKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI 420
           EKKLSQMILDKKFAGTLDQG GCLIIFEDPK +AI+PATLETISN+GKVVDSL++RSAKI
Sbjct: 364 EKKLSQMILDKKFAGTLDQGAGCLIIFEDPKTEAIFPATLETISNVGKVVDSLYMRSAKI 423

Query: 421 MA 422
           MA
Sbjct: 424 MA 425

Source: Oryza sativa Japonica Group

Species: Oryza sativa

Genus: Oryza

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|219884013|gb|ACL52381.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|226493054|ref|NP_001151067.1| LOC100284700 [Zea mays] gi|195644058|gb|ACG41497.1| 26S proteasome non-ATPase regulatory subunit 11 [Zea mays] Back     alignment and taxonomy information
>gi|326490686|dbj|BAJ90010.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|224035057|gb|ACN36604.1| unknown [Zea mays] gi|414587062|tpg|DAA37633.1| TPA: hypothetical protein ZEAMMB73_116974 [Zea mays] Back     alignment and taxonomy information
>gi|242086184|ref|XP_002443517.1| hypothetical protein SORBIDRAFT_08g020840 [Sorghum bicolor] gi|241944210|gb|EES17355.1| hypothetical protein SORBIDRAFT_08g020840 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|225451255|ref|XP_002277010.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 2 [Vitis vinifera] gi|225451257|ref|XP_002276988.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 1 [Vitis vinifera] gi|359487820|ref|XP_003633654.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 [Vitis vinifera] gi|147811910|emb|CAN63723.1| hypothetical protein VITISV_021756 [Vitis vinifera] Back     alignment and taxonomy information
>gi|242073204|ref|XP_002446538.1| hypothetical protein SORBIDRAFT_06g017780 [Sorghum bicolor] gi|241937721|gb|EES10866.1| hypothetical protein SORBIDRAFT_06g017780 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|212722498|ref|NP_001132072.1| uncharacterized protein LOC100193485 [Zea mays] gi|194693348|gb|ACF80758.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|195620064|gb|ACG31862.1| 26S proteasome non-ATPase regulatory subunit 11 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
TAIR|locus:2030017419 ATS9 "AT1G29150" [Arabidopsis 0.981 0.988 0.763 1.6e-159
FB|FBgn0028689422 Rpn6 "Regulatory particle non- 0.995 0.995 0.432 3.5e-91
UNIPROTKB|F6XBL2422 psmd11 "26S proteasome non-ATP 0.964 0.964 0.448 1.6e-88
MGI|MGI:1916327422 Psmd11 "proteasome (prosome, m 0.964 0.964 0.436 7.7e-87
ZFIN|ZDB-GENE-030131-2711421 psmd11a "proteasome (prosome, 0.964 0.966 0.436 7.7e-87
UNIPROTKB|Q2KI42422 PSMD11 "26S proteasome non-ATP 0.964 0.964 0.436 9.9e-87
UNIPROTKB|E2RJ26422 PSMD11 "Uncharacterized protei 0.964 0.964 0.436 9.9e-87
UNIPROTKB|O00231422 PSMD11 "26S proteasome non-ATP 0.964 0.964 0.436 9.9e-87
RGD|1306450422 Psmd11 "proteasome (prosome, m 0.964 0.964 0.436 9.9e-87
ZFIN|ZDB-GENE-030131-984422 psmd11b "proteasome (prosome, 0.964 0.964 0.441 5.4e-86
TAIR|locus:2030017 ATS9 "AT1G29150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1554 (552.1 bits), Expect = 1.6e-159, P = 1.6e-159
 Identities = 317/415 (76%), Positives = 345/415 (83%)

Query:     8 ATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLRQENRAQDLC 67
             ATT++I+ A EA N S+AI++LY+VL+DPSSS EA+R+KE AIT L D L +E R +DL 
Sbjct:     6 ATTETISLALEA-NSSEAITILYQVLEDPSSSPEAIRIKEQAITNLCDRLTEEKRGEDLR 64

Query:    68 NLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQ 127
              LLT+LRPFFSLIPKAKTAKIVRGIIDAVAKIPGT++LQI LCKEMV+WTRAEKRTFLRQ
Sbjct:    65 KLLTKLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTTDLQITLCKEMVEWTRAEKRTFLRQ 124

Query:   128 RVEARLAALLMESREYTEALTLLTSLVKXXXXXXXXXXXXXXXXXXXXXHFSLRXXXXXX 187
             RVEARLAALLME++EY EAL LL++LVK                     HFSLR      
Sbjct:   125 RVEARLAALLMENKEYVEALALLSTLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAK 184

Query:   188 XXXXXXXXXXXXIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYXXXXXXXXNALEDPRAV 247
                         IYVPPAQQGTIDLQSGILHAEEKDYKT YSY        NAL DPRAV
Sbjct:   185 AALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTGYSYFFEAFESFNALGDPRAV 244

Query:   248 FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRD 307
             FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGP+LDAMKAVADAHSKRSLKLFE ALRD
Sbjct:   245 FSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPDLDAMKAVADAHSKRSLKLFENALRD 304

Query:   308 FKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQM 367
             +KAQLE+DPIVHRHLSSLYDTLLEQNLCRLIEP+SRVEIAHIAELI LP+DHVEKKLSQM
Sbjct:   305 YKAQLEDDPIVHRHLSSLYDTLLEQNLCRLIEPFSRVEIAHIAELIGLPLDHVEKKLSQM 364

Query:   368 ILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIMA 422
             ILDKKFAGTLDQG GCLIIFEDPKADAIY ATLETI+NMGKVVDSL+VRSAKIM+
Sbjct:   365 ILDKKFAGTLDQGAGCLIIFEDPKADAIYSATLETIANMGKVVDSLYVRSAKIMS 419
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA;TAS
GO:0005634 "nucleus" evidence=TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006457 "protein folding" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
FB|FBgn0028689 Rpn6 "Regulatory particle non-ATPase 6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F6XBL2 psmd11 "26S proteasome non-ATPase regulatory subunit 11" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1916327 Psmd11 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2711 psmd11a "proteasome (prosome, macropain) 216S subunit, non-ATPase, 11a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI42 PSMD11 "26S proteasome non-ATPase regulatory subunit 11" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ26 PSMD11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00231 PSMD11 "26S proteasome non-ATPase regulatory subunit 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306450 Psmd11 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-984 psmd11b "proteasome (prosome, macropain) 216S subunit, non-ATPase, 11b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O00231PSD11_HUMANNo assigned EC number0.51460.96440.9644yesno
Q20938PS11A_CAEELNo assigned EC number0.46650.94780.9132yesno
Q54UB5PSD11_DICDINo assigned EC number0.51720.89090.9104yesno
Q8BG32PSD11_MOUSENo assigned EC number0.51460.96440.9644yesno
Q7KLV9PSD11_DROMENo assigned EC number0.51300.99520.9952yesno
Q9P7S2RPN6_SCHPONo assigned EC number0.50.95730.9596yesno
F6P3G4PS11A_DANRENo assigned EC number0.51460.96440.9667yesno
Q2KI42PSD11_BOVINNo assigned EC number0.51460.96440.9644yesno
F1LMZ8PSD11_RATNo assigned EC number0.51460.96440.9644yesno
Q12377RPN6_YEASTNo assigned EC number0.44170.88380.8594yesno
Q9LP45PSD11_ARATHNo assigned EC number0.87460.98100.9880yesno
F6XBL2PSD11_XENTRNo assigned EC number0.52680.96440.9644yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
COG5159421 COG5159, RPN6, 26S proteasome regulatory complex c 1e-137
pfam01399100 pfam01399, PCI, PCI domain 1e-21
smart0075388 smart00753, PAM, PCI/PINT associated module 1e-15
smart0008888 smart00088, PINT, motif in proteasome subunits, In 1e-15
>gnl|CDD|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  400 bits (1028), Expect = e-137
 Identities = 174/416 (41%), Positives = 252/416 (60%), Gaps = 6/416 (1%)

Query: 12  SIAQAKEASNPSD---AISMLYRVLDDPSSSSEALR-VKELAITELSDLLRQENRAQDLC 67
           S+  A  A   +D   AI    R+L    S  E     +E  + EL  L   +     L 
Sbjct: 6   SLELANNAVKSNDIEKAIGEYKRILGKGVSKDEKTLNEQEATVLELFKLYVSKGDYCSLG 65

Query: 68  NLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQ 127
           + +T  R       K K  KI+R +I+       + E QI +   +++W   EKR FLR 
Sbjct: 66  DTITSSREAMEDFTKPKITKIIRTLIEKFPYSSDSLEDQIKVLTALIEWADREKRKFLRL 125

Query: 128 RVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAK 187
            +E +L  LL ++ +Y++AL L+  L+ E+++ DDK+ L+ + LLESK++  +RN+ K+K
Sbjct: 126 ELECKLIYLLYKTGKYSDALALINPLLHELKKYDDKINLITVHLLESKVYHEIRNVSKSK 185

Query: 188 AALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALE-DPRA 246
           A+LTAART AN+ Y PP  Q  +DL SGILH +++DYKTA SYF EA E F  L+ D +A
Sbjct: 186 ASLTAARTLANSAYCPPQLQAQLDLLSGILHCDDRDYKTASSYFIEALEGFTLLKMDVKA 245

Query: 247 VFSLKYMLLCKIMVSQADDVAGIISSKAGLQ-YVGPELDAMKAVADAHSKRSLKLFETAL 305
             SLKYMLL KIM+++ ++V  ++ +K  L+ Y    + AM AVA+A   RSLK F  AL
Sbjct: 246 CVSLKYMLLSKIMLNRREEVKAVLRNKNTLKHYDDRMIRAMLAVAEAFGNRSLKDFSDAL 305

Query: 306 RDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLS 365
             +  +L +D  +  HL  LYD LLE+NL ++IEP+S VEI+HIA++I L  + VE KLS
Sbjct: 306 AQYSDELHQDSFIRSHLQYLYDVLLEKNLVKIIEPFSVVEISHIADVIGLDTNQVEGKLS 365

Query: 366 QMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKIM 421
           QMILDK F GTLDQG GCLI++ +P  D  Y   LE +  +  VVDSL+ +++ ++
Sbjct: 366 QMILDKIFYGTLDQGDGCLIVYGEPAQDNTYDEALEQVEALDCVVDSLYEKASALL 421

Length = 421
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 422
KOG1463411 consensus 26S proteasome regulatory complex, subun 100.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 100.0
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 100.0
KOG1498439 consensus 26S proteasome regulatory complex, subun 100.0
COG5071439 RPN5 26S proteasome regulatory complex component [ 100.0
KOG0687393 consensus 26S proteasome regulatory complex, subun 100.0
COG5187412 RPN7 26S proteasome regulatory complex component, 99.97
KOG2908380 consensus 26S proteasome regulatory complex, subun 99.96
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 99.96
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 99.95
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.81
KOG2581493 consensus 26S proteasome regulatory complex, subun 99.8
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 99.58
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.53
smart0075388 PAM PCI/PINT associated module. 99.53
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 99.48
KOG1076843 consensus Translation initiation factor 3, subunit 99.16
KOG2758432 consensus Translation initiation factor 3, subunit 99.07
KOG2753378 consensus Uncharacterized conserved protein, conta 99.06
COG5600413 Transcription-associated recombination protein [DN 98.58
KOG2688394 consensus Transcription-associated recombination p 98.46
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.23
KOG2072 988 consensus Translation initiation factor 3, subunit 97.79
PRK11788389 tetratricopeptide repeat protein; Provisional 97.74
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 97.7
PRK11788389 tetratricopeptide repeat protein; Provisional 97.67
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.55
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 97.11
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.1
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 97.08
KOG1861540 consensus Leucine permease transcriptional regulat 97.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.03
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.97
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.94
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.93
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.78
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 96.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.7
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.69
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.6
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.57
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.52
KOG2003840 consensus TPR repeat-containing protein [General f 96.45
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.4
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 96.35
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.21
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.06
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 96.01
KOG2003840 consensus TPR repeat-containing protein [General f 95.71
KOG1126638 consensus DNA-binding cell division cycle control 95.71
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.68
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 95.65
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.56
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.44
KOG3250258 consensus COP9 signalosome, subunit CSN7 [Posttran 95.37
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 95.36
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.28
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.2
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 95.15
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.09
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 95.05
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.93
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 94.89
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.75
PRK15174656 Vi polysaccharide export protein VexE; Provisional 94.48
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.47
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 94.3
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.17
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.15
KOG1586288 consensus Protein required for fusion of vesicles 94.07
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.98
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 93.86
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 93.6
TIGR02552135 LcrH_SycD type III secretion low calcium response 93.6
PLN03218 1060 maturation of RBCL 1; Provisional 93.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.03
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 92.96
KOG2076 895 consensus RNA polymerase III transcription factor 92.76
PLN03218 1060 maturation of RBCL 1; Provisional 92.27
PRK15359144 type III secretion system chaperone protein SscB; 92.23
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 92.06
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 91.92
PRK10370198 formate-dependent nitrite reductase complex subuni 91.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.82
PRK04841903 transcriptional regulator MalT; Provisional 91.57
KOG2076 895 consensus RNA polymerase III transcription factor 91.54
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 91.45
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 91.44
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 91.17
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 90.99
PRK12370553 invasion protein regulator; Provisional 90.63
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.42
KOG3054299 consensus Uncharacterized conserved protein [Funct 90.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 90.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 90.09
COG3355126 Predicted transcriptional regulator [Transcription 89.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 89.57
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 89.45
PRK10803263 tol-pal system protein YbgF; Provisional 89.24
PRK1543178 ferrous iron transport protein FeoC; Provisional 88.94
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 88.71
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 88.58
PF03704146 BTAD: Bacterial transcriptional activator domain; 88.51
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 88.51
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.45
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 87.92
PRK10747398 putative protoheme IX biogenesis protein; Provisio 87.78
PRK10370198 formate-dependent nitrite reductase complex subuni 87.06
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 86.73
PRK11189296 lipoprotein NlpI; Provisional 86.41
KOG2300 629 consensus Uncharacterized conserved protein [Funct 86.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 86.31
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 86.21
PRK06266178 transcription initiation factor E subunit alpha; V 86.13
PRK14574 822 hmsH outer membrane protein; Provisional 86.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 85.85
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.65
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 85.49
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 85.31
cd05804355 StaR_like StaR_like; a well-conserved protein foun 85.22
PRK14574 822 hmsH outer membrane protein; Provisional 85.11
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 85.01
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 84.87
PF13512142 TPR_18: Tetratricopeptide repeat 84.83
KOG2796366 consensus Uncharacterized conserved protein [Funct 84.79
PF1337173 TPR_9: Tetratricopeptide repeat 84.56
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 84.41
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 84.37
PLN03077857 Protein ECB2; Provisional 84.33
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 83.67
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 83.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 83.38
PLN03077857 Protein ECB2; Provisional 83.33
KOG1941 518 consensus Acetylcholine receptor-associated protei 83.26
PRK10803263 tol-pal system protein YbgF; Provisional 83.06
KOG3785 557 consensus Uncharacterized conserved protein [Funct 83.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 82.98
cd00189100 TPR Tetratricopeptide repeat domain; typically con 82.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.77
KOG2376652 consensus Signal recognition particle, subunit Srp 82.75
KOG2376 652 consensus Signal recognition particle, subunit Srp 82.74
COG3118304 Thioredoxin domain-containing protein [Posttransla 82.49
PF13512142 TPR_18: Tetratricopeptide repeat 81.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 81.69
PRK12370553 invasion protein regulator; Provisional 80.88
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 80.48
KOG4414197 consensus COP9 signalosome, subunit CSN8 [Posttran 80.47
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 80.4
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 80.35
PRK09954 362 putative kinase; Provisional 80.26
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 80.1
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-82  Score=593.36  Aligned_cols=401  Identities=60%  Similarity=0.916  Sum_probs=388.8

Q ss_pred             cchHHHHHhhcCC-hHHHHHHHHhhcCC---CCCchHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHhchhhcccchhH
Q 014555            9 TTDSIAQAKEASN-PSDAISMLYRVLDD---PSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAK   84 (422)
Q Consensus         9 ~~~~~ak~~~~~~-~~~Ai~~l~~i~~~---~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~l~~~~~~~~k~~   84 (422)
                      +..+.|+.+.+.+ .++++..|..|.+.   .+++++.++.+|.++.++++++.+.|+.+++.++++++++|+++++|++
T Consensus         6 ~~~e~~~~~~~~~~~~~~~~il~~vl~~~~~~~s~e~~i~~kE~~Ilel~~ll~~~~~~~~lr~li~~~Rpf~~~v~Kak   85 (411)
T KOG1463|consen    6 SLLERAQNLVSVNQVEEAINILKSVLNKAQGASSDEARIKEKEQSILELGDLLAKEGDAEELRDLITSLRPFLSSVSKAK   85 (411)
T ss_pred             HHHHHHHHhcccchhhhhHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHHhhhHH
Confidence            3577888888887 49999999999984   4577778999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCCChhHHHHHHHHHHHHHHhcchhHHhhHHHHHHHHHHHhcccHHHHHHHHHHHHHHHhhhccch
Q 014555           85 TAKIVRGIIDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKL  164 (422)
Q Consensus        85 ~~k~v~~~l~~~~~~~~~~~~~~~l~~~~i~~~~~~~r~~lr~~l~~~La~~~~~~g~~~~A~~~l~~l~~e~~~~~~~~  164 (422)
                      ++|+||.++|.+..+|++.+.+++||++||+||..|+|.|||++|+.||+.+|.+.++|.+|+.+++.++.|+++.||+.
T Consensus        86 aaKlvR~Lvd~~~~~~~~~~~~i~l~~~cIeWA~~ekRtFLRq~Learli~Ly~d~~~YteAlaL~~~L~rElKKlDDK~  165 (411)
T KOG1463|consen   86 AAKLVRSLVDMFLKIDDGTGDQIELCTECIEWAKREKRTFLRQSLEARLIRLYNDTKRYTEALALINDLLRELKKLDDKI  165 (411)
T ss_pred             HHHHHHHHHHHHccCCCCcchHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhccccc
Confidence            99999999999999999989999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHhhccCCCCchhhHHHHHHHHHHhchhhcHHHHHHHHHHHhhhhhccCC-
Q 014555          165 LLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDLQSGILHAEEKDYKTAYSYFFEAFEAFNALED-  243 (422)
Q Consensus       165 ~~~e~~l~~~~~~~~~~n~~kak~~l~~a~~~~~~i~~~~~i~a~i~~~~g~~~~~~~dy~~A~~~f~ea~~~~~~~~~-  243 (422)
                      .++|++++|++.|+.++|++|||+.++.|++.+|++||||.+||.++.++|++|+.++||++|++||||||++|++.++ 
T Consensus       166 lLvev~llESK~y~~l~Nl~KakasLTsART~AnaiYcpPqlQa~lDLqSGIlha~ekDykTafSYFyEAfEgf~s~~~~  245 (411)
T KOG1463|consen  166 LLVEVHLLESKAYHALRNLPKAKASLTSARTTANAIYCPPQLQATLDLQSGILHAAEKDYKTAFSYFYEAFEGFDSLDDD  245 (411)
T ss_pred             ceeeehhhhhHHHHHHhcchhHHHHHHHHHHhhcccccCHHHHHHHHHhccceeecccccchHHHHHHHHHccccccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999988 


Q ss_pred             hhHHHHHHHHHHHHHHhcCccchhhhhcccccccccCcchHHHHHHHHHHhcCCHHHHHHHHHHhHHhhhcChhHHHhHH
Q 014555          244 PRAVFSLKYMLLCKIMVSQADDVAGIISSKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLS  323 (422)
Q Consensus       244 ~~~~~~lky~vL~~lL~~~~~el~~ll~~~~~~~~~~~~i~~~~~L~~af~~~dl~~f~~~l~~~~~~l~~D~~l~~~~~  323 (422)
                      +++...||||+||+||.+.+++++.+++++.+..|.+|.+++|+.+..||.++++..|+..|..|+.++..||+++.|+.
T Consensus       246 v~A~~sLKYMlLcKIMln~~ddv~~lls~K~~l~y~g~~i~AmkavAeA~~nRSLkdF~~AL~~yk~eL~~D~ivr~Hl~  325 (411)
T KOG1463|consen  246 VKALTSLKYMLLCKIMLNLPDDVAALLSAKLALKYAGRDIDAMKAVAEAFGNRSLKDFEKALADYKKELAEDPIVRSHLQ  325 (411)
T ss_pred             HHHHHHHHHHHHHHHHhcCHHHHHHHHhhHHHHhccCcchHHHHHHHHHhcCCcHHHHHHHHHHhHHHHhcChHHHHHHH
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcccccccchhHHHHhCCChHHHHHHHHhhhhcCCceeeeecCCCEEEEecCCchhhHHHHHHHHH
Q 014555          324 SLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETI  403 (422)
Q Consensus       324 ~L~~~i~~~~l~~i~~pYs~I~l~~la~~l~l~~~evE~~l~~mI~~g~i~gkIDq~~g~v~~~~~~~~~~~~~~l~~~~  403 (422)
                      .|++++.|+||.++++|||+|.+++||+.+|+|++.||+.|++||+|+++.|.+||++|+++++++++.++.|+..++++
T Consensus       326 ~Lyd~lLEknl~riIEPyS~Vei~hIA~~IGl~~~~VEkKLsqMILDKkf~G~LDQg~g~Liv~~e~~~d~~y~~aLetI  405 (411)
T KOG1463|consen  326 SLYDNLLEKNLCRIIEPYSRVEISHIAEVIGLDVPQVEKKLSQMILDKKFYGTLDQGEGCLIVFEEPPADNTYDAALETI  405 (411)
T ss_pred             HHHHHHHHHhHHHHcCchhhhhHHHHHHHHCCCcHHHHHHHHHHHHHHHhhcccccCCCeEEEeCCCCcchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHH
Q 014555          404 SNMGKV  409 (422)
Q Consensus       404 ~~l~~l  409 (422)
                      ++++.|
T Consensus       406 ~~m~kV  411 (411)
T KOG1463|consen  406 QNMGKV  411 (411)
T ss_pred             HhccCC
Confidence            998754

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG3250 consensus COP9 signalosome, subunit CSN7 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>KOG4414 consensus COP9 signalosome, subunit CSN8 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
3txm_A394 Crystal Structure Of Rpn6 From Drosophila Melanogas 3e-98
4b4t_Q434 Near-Atomic Resolution Structural Model Of The Yeas 1e-63
>pdb|3TXM|A Chain A, Crystal Structure Of Rpn6 From Drosophila Melanogaster, Gd(3+) Complex Length = 394 Back     alignment and structure 
Iteration: 1

 Score =  355 bits (910), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/384 (46%), Positives = 249/384 (64%), Gaps = 1/384 (0%)
Query: 38  SSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVA 97
           +  E +R+KE  I +  +L +QE +A++L +L+   RPF S I KAK AK+VR ++D   
Sbjct: 10  NDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFL 69
Query: 98  KIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKXX 157
            +   + +++ LCK+ ++W + EKRTFLRQ +EARL AL  ++  YTEAL L   L++  
Sbjct: 70  DMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLREL 129
Query: 158 XXXXXXXXXXXXXXXXXXXHFSLRXXXXXXXXXXXXXXXXXXIYVPPAQQGTIDLQSGIL 217
                              + +L                   IY PP  QG +DLQSGIL
Sbjct: 130 KKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGIL 189
Query: 218 HA-EEKDYKTAYSYXXXXXXXXNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGL 276
           HA +E+D+KTA+SY        ++++  +A+ SLKYMLLCKIM+ Q+DDV  ++S K  +
Sbjct: 190 HAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAI 249
Query: 277 QYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCR 336
            Y G ++DAMK+VA+A  KRSL  F+ AL+++K +L ED IV  HL +LYDT+LEQNLCR
Sbjct: 250 TYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCR 309
Query: 337 LIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIY 396
           +IEPYSRV++AH+AE I+LP+  VEKKLSQMILDKKF+G LDQG G LI+FE+   D  Y
Sbjct: 310 IIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTY 369
Query: 397 PATLETISNMGKVVDSLFVRSAKI 420
              LETI +MGKVVD+L+ ++ K+
Sbjct: 370 ERVLETIQSMGKVVDTLYQKAKKL 393
>pdb|4B4T|Q Chain Q, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 1e-116
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 6e-09
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  343 bits (880), Expect = e-116
 Identities = 211/389 (54%), Positives = 292/389 (75%), Gaps = 1/389 (0%)

Query: 33  LDDPSSSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGI 92
            +   +  E +R+KE  I +  +L +QE +A++L +L+   RPF S I KAK AK+VR +
Sbjct: 5   QEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSL 64

Query: 93  IDAVAKIPGTSELQIALCKEMVQWTRAEKRTFLRQRVEARLAALLMESREYTEALTLLTS 152
           +D    +   + +++ LCK+ ++W + EKRTFLRQ +EARL AL  ++  YTEAL L   
Sbjct: 65  VDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQ 124

Query: 153 LVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAANAIYVPPAQQGTIDL 212
           L++E+++LDDK LLV++ LLESK + +L NLPKA+AALT+ART ANAIY PP  QG +DL
Sbjct: 125 LLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDL 184

Query: 213 QSGILHA-EEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIIS 271
           QSGILHA +E+D+KTA+SYF+EAFE F++++  +A+ SLKYMLLCKIM+ Q+DDV  ++S
Sbjct: 185 QSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVS 244

Query: 272 SKAGLQYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLE 331
            K  + Y G ++DAMK+VA+A  KRSL  F+ AL+++K +L ED IV  HL +LYDT+LE
Sbjct: 245 GKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLE 304

Query: 332 QNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPK 391
           QNLCR+IEPYSRV++AH+AE I+LP+  VEKKLSQMILDKKF+G LDQG G LI+FE+  
Sbjct: 305 QNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETP 364

Query: 392 ADAIYPATLETISNMGKVVDSLFVRSAKI 420
            D  Y   LETI +MGKVVD+L+ ++ K+
Sbjct: 365 VDKTYERVLETIQSMGKVVDTLYQKAKKL 393
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 100.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.97
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.88
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.83
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.78
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.73
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 99.33
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 98.77
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.74
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.68
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.61
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.53
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.39
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.33
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.33
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.26
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.22
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.2
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.1
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.02
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.88
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.8
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.79
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.79
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.69
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.64
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.63
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.62
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.61
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.61
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.6
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.56
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.56
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.55
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.54
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.52
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.49
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.43
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.41
3u4t_A272 TPR repeat-containing protein; structural genomics 97.34
3u4t_A272 TPR repeat-containing protein; structural genomics 97.33
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.28
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.27
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.27
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.25
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.24
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 97.18
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.15
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.06
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.89
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.83
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 96.79
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 96.77
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.7
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.69
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.51
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.5
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.48
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.44
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.35
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.18
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.17
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.13
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.04
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.01
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.96
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.94
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.93
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.78
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.75
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.74
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.72
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.67
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.65
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 95.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.47
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.44
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.39
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.33
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.31
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.28
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.22
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.03
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.01
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.97
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 94.87
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.86
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.82
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 94.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.69
4g1t_A 472 Interferon-induced protein with tetratricopeptide 94.55
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 94.44
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 94.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.17
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.08
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 94.03
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.92
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 93.86
4g1t_A472 Interferon-induced protein with tetratricopeptide 93.81
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.73
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.64
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 93.6
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 93.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 93.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.89
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 92.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 92.8
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 92.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 92.37
3k9i_A117 BH0479 protein; putative protein binding protein, 92.35
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 92.3
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 92.05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 91.88
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 91.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 91.48
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 91.31
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 90.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 90.81
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 90.65
1qbj_A81 Protein (double-stranded RNA specific adenosine D 90.65
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 90.48
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.41
3t5v_A316 Nuclear mRNA export protein SAC3; PCI, mRNA nuclea 90.32
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 90.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 89.99
2kat_A115 Uncharacterized protein; NESG, structure, structur 89.95
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 89.8
3k9i_A117 BH0479 protein; putative protein binding protein, 89.74
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 89.72
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.56
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 89.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 89.13
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 89.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 88.82
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 88.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 88.46
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 88.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 87.72
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 87.53
2jt1_A77 PEFI protein; solution structure, winged helix-tur 87.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 87.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 86.93
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 86.91
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 86.79
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 86.63
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 86.31
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 86.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 85.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 85.3
1sfx_A109 Conserved hypothetical protein AF2008; structural 85.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 85.03
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 84.84
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 84.82
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 84.67
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 84.52
2kat_A115 Uncharacterized protein; NESG, structure, structur 84.13
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 83.7
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 83.26
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 82.8
3r0a_A123 Putative transcriptional regulator; structural gen 81.95
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 81.8
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 81.47
2oqg_A114 Possible transcriptional regulator, ARSR family P; 81.06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 80.42
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 80.28
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 80.21
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 80.14
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
Probab=100.00  E-value=4.2e-78  Score=603.62  Aligned_cols=383  Identities=55%  Similarity=0.911  Sum_probs=343.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHhchhhcccchhHHHHHHHHHHHHhhcCCCChhHHHHHHHHHHHHH
Q 014555           38 SSSEALRVKELAITELSDLLRQENRAQDLCNLLTQLRPFFSLIPKAKTAKIVRGIIDAVAKIPGTSELQIALCKEMVQWT  117 (422)
Q Consensus        38 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~l~~~~~~~~k~~~~k~v~~~l~~~~~~~~~~~~~~~l~~~~i~~~  117 (422)
                      ++++.++.+|.++.+|+++|++.|+++++.++++.+++|++.++|++++|+||+++|.++.+|++.+.++++|.++++||
T Consensus        10 ~~~~~~~~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~kak~~k~v~~l~~~~~~~~~~~~~~~~~~~~~~~~a   89 (394)
T 3txn_A           10 NDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWA   89 (394)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHTTTGGGGSCHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHH
Confidence            45667999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcchhHHhhHHHHHHHHHHHhcccHHHHHHHHHHHHHHHhhhccchhHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHhh
Q 014555          118 RAEKRTFLRQRVEARLAALLMESREYTEALTLLTSLVKEVRRLDDKLLLVDIDLLESKLHFSLRNLPKAKAALTAARTAA  197 (422)
Q Consensus       118 ~~~~r~~lr~~l~~~La~~~~~~g~~~~A~~~l~~l~~e~~~~~~~~~~~e~~l~~~~~~~~~~n~~kak~~l~~a~~~~  197 (422)
                      ++++|+|||++|+.||+++|++.|+|.+|++++++++.+|++.||+.+++|+++.++++|+..+|+++++++|++|+++.
T Consensus        90 ~~~~r~flr~~l~~kL~~l~~~~~~y~~a~~~i~~l~~~~~~~dd~~~llev~lle~~~~~~~~n~~k~k~~l~~a~~~~  169 (394)
T 3txn_A           90 KQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTA  169 (394)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTSSCTHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhccccchhHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCchhhHHHHHHHHHHhc-hhhcHHHHHHHHHHHhhhhhccCChhHHHHHHHHHHHHHHhcCccchhhhhcccccc
Q 014555          198 NAIYVPPAQQGTIDLQSGILHA-EEKDYKTAYSYFFEAFEAFNALEDPRAVFSLKYMLLCKIMVSQADDVAGIISSKAGL  276 (422)
Q Consensus       198 ~~i~~~~~i~a~i~~~~g~~~~-~~~dy~~A~~~f~ea~~~~~~~~~~~~~~~lky~vL~~lL~~~~~el~~ll~~~~~~  276 (422)
                      +++||||+++|.+++|+|++|+ .+|||++|+++|+|+|++|++.+++++.++++|++||+|++++++++++++.++.+.
T Consensus       170 ~ai~~~p~i~a~i~~~~Gi~~l~~~rdyk~A~~~F~eaf~~f~~~~~~~~~~~lkYlvL~aLl~~~r~el~~~l~~~~~~  249 (394)
T 3txn_A          170 NAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAI  249 (394)
T ss_dssp             HHSCCCHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHTTCGGGHHHHHHSHHHH
T ss_pred             ccCCCCHHHHHHHHHHhhHHHHHhccCHHHHHHHHHHHHhcccccccHHHHHHHHHHHHHHHHcCCHHHHHHHhcccccc
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999988777666


Q ss_pred             cccCcchHHHHHHHHHHhcCCHHHHHHHHHHhHHhhhcChhHHHhHHHHHHHHHHHHHHHhhcccccccchhHHHHhCCC
Q 014555          277 QYVGPELDAMKAVADAHSKRSLKLFETALRDFKAQLEEDPIVHRHLSSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELP  356 (422)
Q Consensus       277 ~~~~~~i~~~~~L~~af~~~dl~~f~~~l~~~~~~l~~D~~l~~~~~~L~~~i~~~~l~~i~~pYs~I~l~~la~~l~l~  356 (422)
                      .|.+|+++||..|+.+|+++++..|..+++.|++.|..||++++|+..|+++|+++||+++++||++|+|++||+.||+|
T Consensus       250 ~~~~pei~~l~~L~~a~~~~dl~~f~~iL~~~~~~l~~D~~l~~h~~~L~~~Ir~~~L~~i~~pYsrIsl~~iA~~l~ls  329 (394)
T 3txn_A          250 TYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLP  329 (394)
T ss_dssp             TTCSHHHHHHHHHHHHHHTTCHHHHHHHHHHSTTTTTTSHHHHHHHHHHHHHHHHHHHHHHHTTCSEEEHHHHHHHHTCC
T ss_pred             ccCCccHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHhHhhceeeHHHHHHHHCcC
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhhhhcCCceeeeecCCCEEEEecCCchhhHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 014555          357 IDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKADAIYPATLETISNMGKVVDSLFVRSAKI  420 (422)
Q Consensus       357 ~~evE~~l~~mI~~g~i~gkIDq~~g~v~~~~~~~~~~~~~~l~~~~~~l~~l~~~l~~~~~~~  420 (422)
                      ++++|++|++||.+|+|+|+|||++|+|++.++++++.+|+.+++.+++++++||.||+|++++
T Consensus       330 ~~evE~~L~~lI~dg~I~a~IDq~~giv~~~~~~~r~~~y~~ale~l~~ls~vVd~L~~~~~~~  393 (394)
T 3txn_A          330 MPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQKAKKL  393 (394)
T ss_dssp             HHHHHHHHHHHHHTTSSCEEEETTTTEEEECCC-------------------------------
T ss_pred             HHHHHHHHHHHHHCCCeeEEEcCCCCEEEECCCcchhhHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999999999999999999986
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 422
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 1e-15
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 69.4 bits (170), Expect = 1e-15
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 323 SSLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVG 382
           S L   ++E NL    + Y+ +    +  L+E+P    EK  SQMI + +  G +DQ  G
Sbjct: 10  SILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDG 69

Query: 383 CLIIFEDPKA 392
             + FE  +A
Sbjct: 70  I-VHFETREA 78

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.7
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.85
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.59
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.08
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.98
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.91
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 96.6
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.13
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.95
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.89
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.75
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.73
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.58
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.42
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.27
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.08
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.99
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.55
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 92.91
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 92.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.62
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 92.48
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.27
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.14
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 91.68
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 91.15
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 90.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 90.28
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 89.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 88.96
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.45
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 87.28
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 86.85
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 86.22
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 85.92
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 85.01
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 84.17
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 83.65
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.68  E-value=1.7e-17  Score=127.48  Aligned_cols=69  Identities=26%  Similarity=0.380  Sum_probs=65.4

Q ss_pred             HHHHHHHHHHHHHhhcccccccchhHHHHhCCChHHHHHHHHhhhhcCCceeeeecCCCEEEEecCCch
Q 014555          324 SLYDTLLEQNLCRLIEPYSRVEIAHIAELIELPIDHVEKKLSQMILDKKFAGTLDQGVGCLIIFEDPKA  392 (422)
Q Consensus       324 ~L~~~i~~~~l~~i~~pYs~I~l~~la~~l~l~~~evE~~l~~mI~~g~i~gkIDq~~g~v~~~~~~~~  392 (422)
                      -|+++|+||||+.+.+||++|+|++||+.|++|++++|.+|++||.+|+|+|+|||++|+|+|..++..
T Consensus        11 ~L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~~   79 (84)
T d1ufma_          11 ILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREAS   79 (84)
T ss_dssp             CCCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSCC
T ss_pred             HHHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCcC
Confidence            378999999999999999999999999999999999999999999999999999999999999876543
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure