Citrus Sinensis ID: 014576

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--

MRLSGDVAGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKQAVTAMVQQAMQYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDADPSKEKKKPKEGDNVVEEAPADIPSLLELKRIYYELMIRYYSHNNDYLEICRCYKAIYEIPYIKEDPAQWMPVLRKICWYLVLAPHDPMQSSLLNSTLEDKNLSEIPNFRLLLKQLVTMEVIQWTSLWNTYKDEFENETNMLGGSLGAKAAEDLRQRIIEHNILVVSKYYSRITLKRLAELLCLSIQEAEKHLSDMVVSKALVAKIDRPQGIVCFQVAKDSNDILNSWAMNLEKLLDLVEKSCHQIHKETMVHKTALKV

ccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*******AGTKKAVTEILQLCFEAKDWKTLNEQIVNLSKKRGQLKQAVTAMVQQAMQYIDQTPDLDTRIELIKTLNSVSAGKIYVEIERARLIKKLAKIKEEQGLIAEAADLMQEVAVETFGAMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPRVFDADP****KK****DNVVEEAPADIPSLLELKRIYYELMIRYYSHNNDYLEICRCYKAIYEIPYIKEDPAQWMPVLRKICWYLVLAPHDPMQSS*****LEDKNLSEIPNFRLLLKQLVTMEVIQWTSLWNTYKDEFENETNMLGGSLGAKAAEDLRQRIIEHNILVVSKYYSRITLKRLAELLCLSIQEAEKHLSDMVVSKALVAKIDRPQGIVCFQVAKDSNDILNSWAMNLEKLLDLVEKSCHQIHKETMVHKTAL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
26S proteasome regulatory subunit rpn5	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Required for proper proteasome assembly.	probable	Q9UTM3
26S proteasome non-ATPase regulatory subunit 12	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	probable	O00232
26S proteasome regulatory subunit RPN5	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	probable	Q12250

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain P
Confidence level:very confident
Coverage over the Query: 1-165,189-378
View the alignment between query and template
View the model in PyMOL

Template: 3EDT, chain B
Confidence level:probable
Coverage over the Query: 5-223
View the alignment between query and template
View the model in PyMOL