Citrus Sinensis ID: 014577

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--

MKVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPLWASSPLPVSLSSLPPVGDVGYFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESISDKEWVANFEKPKGDPSAYLKPATTVLSPYLKFGCLSSRYFYQCLTDVYQNVKKHTSPPVSLVGQLLWRDFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWGWMHHLARHCVACFLTRGDMFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQYNRIYSPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVVSHDSASKECKRKLGEAYALNQKLNGQVSEDGLKNLRRKFEGEENQESGRRQKQKTLTGWLKDH

cHHHHHHHHcccEEEEEcccCECccHHHccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHccccccccccccccccccccccHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccHHcccccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccccccccccc

MKVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPLWASSPLPVSLSSLP******YFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESISDKEWVANFEKPKGDPSAYLKPATTVLSPYLKFGCLSSRYFYQCLTDVYQNVKKHTSPPVSLVGQLLWRDFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWGWMHHLARHCVACFLTRGDMFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQYNRIYSPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVVSHDSASKECKRKLGE************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
(6-4)DNA photolyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the photoreactivation of pyrimidine [6-4] pyrimidone photoproduct (6-4 products). Binds specifically to DNA containing 6-4 products and repairs these lesions in a visible light-dependent manner. Not required for repair of cyclobutane pyrimidine dimer (CPD).	probable	O48652
(6-4)DNA photolyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the photoreactivation of pyrimidine [6-4] pyrimidone photoproduct (6-4 products).	probable	Q0E2Y1
Cryptochrome-1	Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK\|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK\|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.	probable	P97784

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.1.-.-	Carbon-carbon lyases.	probable
4.1.99.-	Other carbon-carbon lyases.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 2-404
View the alignment between query and template
View the model in PyMOL