Citrus Sinensis ID: 014592

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--

MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

ccEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHccccccccEEEcccEEEEccHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccHHcEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHcccccccEEEEEEEEccccccEEEEEEHHHHHHHHHHHcccccccEEEEEEcccccccEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHccccccccEEcccccccc

ccEEEEEccccHHHHHHHHHHHHcccEEEEEcccccccccccccHHHccccccccEEEEccEEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEccHEcHHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHccHHHHHHHcccHHHHcccccccHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccHHHcccccccHHHHHHHcccccccccccHHHHHHHHccccccEEEEEEEcccHHccEEEEcccHHHHHHHHHHHHHHHHHEEEEEEEcccccEEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccEcccccEcc

mplvlhagntNKNAFKALITAEYTGVNVELVKNFEmgvtnktpeflkmnpigkvpvletpdgpifesNAIARYVARLKadnpllgsslidsaHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRIlsksftsefphiERYFWTMVNIPNFRKILGEIkqaesvppvqsakkptqskepakpkaqaepkkeAAKEtakpkvedageeeapkpkpknpldllppskmiLDEWKRLYSNTKTNFREVAIKGfwdmydpegyslwfcdykyndentVSFVTLNKVGGFLQRMDLARKYAFGKMliigseppfkvkglwlfrgqeipqfimdecydmelydwkkvdindEAQKERVSQMIedhepfegealldakcfk

MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGvtnktpeflkmnpIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAEsvppvqsakkptqskepakpkaqaepkkeaaketakpkvedageeeapkpkpknpldllppSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEdhepfegealldakcfk

MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEaaiaslkralaalNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSkepakpkaqaepkkeaaketakpkVEDAGeeeapkpkpknpldllppSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

********NTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEI*******************************************************************MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDIN******************************

MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESV******************************************************DLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAE***************************************************PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

*PLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKP*****************************************KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		422	2.2.26 [Sep-21-2011]
Q9FUM1		422	Elongation factor 1-gamma	N/A	no	1.0	1.0	0.791	0.0
Q6YW46		418	Elongation factor 1-gamma	yes	no	0.985	0.995	0.797	0.0
Q5Z627		416	Elongation factor 1-gamma	no	no	0.985	1.0	0.786	0.0
Q9ZRI7		418	Elongation factor 1-gamma	no	no	0.981	0.990	0.765	0.0
O04487		414	Probable elongation facto	yes	no	0.981	1.0	0.746	0.0
Q9FVT2		413	Probable elongation facto	no	no	0.978	1.0	0.736	1e-180
Q9D8N0		437	Elongation factor 1-gamma	yes	no	0.978	0.945	0.373	3e-73
P29694		437	Elongation factor 1-gamma	yes	no	0.978	0.945	0.369	1e-72
A2Q127		437	Elongation factor 1-gamma	yes	no	0.978	0.945	0.366	3e-72
Q68FR6		437	Elongation factor 1-gamma	yes	no	0.978	0.945	0.366	3e-72

>sp\|Q9FUM1\|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1	Back alignment and function desciption

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/422 (79%), Positives = 369/422 (87%)

Query: 1   MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP 60
           M LVLHAG TNKNAFK LI AEYTGV VEL  +FEMGVTNKTPE+LK+NPIGKVP+LETP
Sbjct: 1   MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLETP 60

Query: 61  DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA 120
           DGPIFESNAIARYVARLKADNPL+GSSLID AHIEQWIDF SLEID NI+ WF PR G+A
Sbjct: 61  DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGYA 120

Query: 121 VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFT 180
           VYLP AEEAAI++LKRAL ALNTHLASNTYLVGH VTLADII+TCNL  GF++++ KSFT
Sbjct: 121 VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLFFGFTKLMIKSFT 180

Query: 181 SEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEA 240
           SEFPH+ERYFWT+VN P F+K+LG++KQ ESVPPV SAKKP+Q KE      +   K+  
Sbjct: 181 SEFPHVERYFWTLVNQPKFKKVLGDVKQTESVPPVPSAKKPSQPKETKSKAKEEPKKEAK 240

Query: 241 AKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWD 300
            +            EEAPKPKPKNPLDLLPPS M+LD+WKRLYSNTKTNFREVAIKGFWD
Sbjct: 241 KEPAKPKAEAAEEVEEAPKPKPKNPLDLLPPSNMVLDDWKRLYSNTKTNFREVAIKGFWD 300

Query: 301 MYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVK 360
           MYDPEGYSLWFC+YKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKML+IGSEPPFKVK
Sbjct: 301 MYDPEGYSLWFCEYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVK 360

Query: 361 GLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKC 420
           GLWLFRGQEIP F+M+ECYDMELY+W KVD++DE QKERV+Q+IED EPFEGEALLDAKC
Sbjct: 361 GLWLFRGQEIPPFVMEECYDMELYNWTKVDLSDENQKERVNQVIEDQEPFEGEALLDAKC 420

Query: 421 FK 422
           FK
Sbjct: 421 FK 422

Probably plays a role in anchoring the complex to other cellular components.
Prunus avium (taxid: 42229)

>sp\|Q6YW46\|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2	Back alignment and function description

>sp\|Q5Z627\|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZRI7\|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1	Back alignment and function description

>sp\|O04487\|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1	Back alignment and function description

>sp\|Q9FVT2\|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1	Back alignment and function description

>sp\|Q9D8N0\|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3	Back alignment and function description

>sp\|P29694\|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3	Back alignment and function description

>sp\|A2Q127\|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1	Back alignment and function description

>sp\|Q68FR6\|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		422
225465198		423	PREDICTED: elongation factor 1-gamma-lik	1.0	0.997	0.846	0.0
147789055		423	hypothetical protein VITISV_021574 [Viti	1.0	0.997	0.839	0.0
359493457		424	PREDICTED: elongation factor 1-gamma-lik	0.997	0.992	0.847	0.0
224145107		426	predicted protein [Populus trichocarpa]	0.992	0.983	0.843	0.0
13626392		422	RecName: Full=Elongation factor 1-gamma;	1.0	1.0	0.791	0.0
363808162		420	uncharacterized protein LOC100810452 [Gl	0.990	0.995	0.809	0.0
242096224		417	hypothetical protein SORBIDRAFT_10g02257	0.985	0.997	0.780	0.0
413926103		414	elongation factor 1-gamma 2 [Zea mays] g	0.976	0.995	0.771	0.0
356543373		418	PREDICTED: elongation factor 1-gamma-lik	0.990	1.0	0.796	0.0
357124051		413	PREDICTED: elongation factor 1-gamma 2-l	0.978	1.0	0.770	0.0

>gi\|225465198\|ref\|XP_002264400.1\| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/423 (84%), Positives = 383/423 (90%), Gaps = 1/423 (0%)

Query: 1   MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP 60
           M LVLHAG TNKNA+K LI AEY+G+ VELV+NFEMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct: 1   MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP 60

Query: 61  DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA 120
           DGP+FESNAIARYV RLKADNPL GSS I+  HIEQWIDF+SLEID NI  WF PR+G A
Sbjct: 61  DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA 120

Query: 121 VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFT 180
           VYLP  EEAAIA+LKRAL ALNTHLASNT+LVGHSVTLADI+MTCNL +GFS++++KSFT
Sbjct: 121 VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSVTLADIVMTCNLYMGFSKLMTKSFT 180

Query: 181 SEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEA 240
           SEFPH+ERYFWTMVN PNF KILGE+KQ  SVPPV SAKKP   KE AKPK + EPKKE 
Sbjct: 181 SEFPHVERYFWTMVNQPNFSKILGEVKQTASVPPVSSAKKPALPKEHAKPKHKDEPKKEV 240

Query: 241 AKETAKPKVEDAG-EEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFW 299
            KE AKPK    G EEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFW
Sbjct: 241 KKEPAKPKEAPVGEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFW 300

Query: 300 DMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKV 359
           DMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKML+IGSE PFKV
Sbjct: 301 DMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEAPFKV 360

Query: 360 KGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAK 419
           KGLWLFRGQEIPQFI+DECYDMELY+WKKVDI+DEAQKERV+QMIED EPFEGEALLDAK
Sbjct: 361 KGLWLFRGQEIPQFIIDECYDMELYEWKKVDISDEAQKERVNQMIEDQEPFEGEALLDAK 420

Query: 420 CFK 422
           CFK
Sbjct: 421 CFK 423

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147789055\|emb\|CAN75785.1\| hypothetical protein VITISV_021574 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493457\|ref\|XP_002278756.2\| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224145107\|ref\|XP_002325529.1\| predicted protein [Populus trichocarpa] gi\|222862404\|gb\|EEE99910.1\| predicted protein [Populus trichocarpa] gi\|283136134\|gb\|ADB11386.1\| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|13626392\|sp\|Q9FUM1.1\|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: Full=eEF-1B gamma gi\|10444415\|gb\|AAG17901.1\|AF297712_1 translation elongation factor 1-gamma [Prunus avium]	Back alignment and taxonomy information

>gi\|363808162\|ref\|NP_001242737.1\| uncharacterized protein LOC100810452 [Glycine max] gi\|255635419\|gb\|ACU18062.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|242096224\|ref\|XP_002438602.1\| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor] gi\|241916825\|gb\|EER89969.1\| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|413926103\|gb\|AFW66035.1\| elongation factor 1-gamma 2 [Zea mays] gi\|413926104\|gb\|AFW66036.1\| elongation factor 1-gamma 2 [Zea mays]	Back alignment and taxonomy information

>gi\|356543373\|ref\|XP_003540135.1\| PREDICTED: elongation factor 1-gamma-like [Glycine max]	Back alignment and taxonomy information

>gi\|357124051\|ref\|XP_003563720.1\| PREDICTED: elongation factor 1-gamma 2-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		422
TAIR\|locus:2206535		413	AT1G57720 [Arabidopsis thalian	0.523	0.535	0.656	3.9e-153
TAIR\|locus:2024311		414	AT1G09640 [Arabidopsis thalian	0.526	0.536	0.654	4.5e-152
MGI\|MGI:1914410		437	Eef1g "eukaryotic translation	0.495	0.478	0.403	2e-61
RGD\|1302939		437	Eef1g "eukaryotic translation	0.495	0.478	0.399	5.4e-61
UNIPROTKB\|F1MG05		440	EEF1G "Elongation factor 1-gam	0.495	0.475	0.394	1.4e-60
UNIPROTKB\|Q29387		432	EEF1G "Elongation factor 1-gam	0.495	0.483	0.399	1.8e-60
UNIPROTKB\|E2R574		437	EEF1G "Uncharacterized protein	0.495	0.478	0.394	2.3e-60
UNIPROTKB\|Q3SZV3		440	EEF1G "Elongation factor 1-gam	0.495	0.475	0.394	4.8e-60
DICTYBASE\|DDB_G0282979		410	efa1G "elongation factor 1 gam	0.511	0.526	0.351	4.8e-60
UNIPROTKB\|B4DTG2		487	EEF1G "cDNA FLJ56389, highly s	0.485	0.420	0.384	9.9e-60

TAIR\|locus:2206535 AT1G57720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 771 (276.5 bits), Expect = 3.9e-153, Sum P(2) = 3.9e-153
 Identities = 145/221 (65%), Positives = 170/221 (76%)

Query:     1 MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP 60
             M LV+H    NK A KALI AEY GV +E   +F+MGVTNK+PEFLKMNPIGKVPVLETP
Sbjct:     1 MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP 60

Query:    61 DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA 120
             +GPIFESNAIARYV+R   DN L GSSLI+ AHIEQWIDFSSLEID N+L+WF PR+G+A
Sbjct:    61 EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA 120

Query:   121 VYLPQAEEXXXXXXXXXXXXXNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFT 180
              +   AEE             NTHLASNT+LVGHSVTLADI+  CNL LGF+ +++K FT
Sbjct:   121 PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFT 180

Query:   181 SEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKP 221
             S FPH+ERYFWTMVN P F+K+LG+ KQ E+VPPV + K P
Sbjct:   181 SAFPHVERYFWTMVNQPEFKKVLGDAKQTEAVPPVPTKKAP 221

GO:0003746 "translation elongation factor activity" evidence=IEA;ISS

GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=IEA

GO:0006414 "translational elongation" evidence=IEA

GO:0005773 "vacuole" evidence=IDA

GO:0005618 "cell wall" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0005507 "copper ion binding" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0010043 "response to zinc ion" evidence=IEP

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

TAIR\|locus:2024311 AT1G09640 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

MGI\|MGI:1914410 Eef1g "eukaryotic translation elongation factor 1 gamma" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1302939 Eef1g "eukaryotic translation elongation factor 1 gamma" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MG05 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q29387 EEF1G "Elongation factor 1-gamma" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R574 EEF1G "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZV3 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0282979 efa1G "elongation factor 1 gamma" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DTG2 EEF1G "cDNA FLJ56389, highly similar to Elongation factor 1-gamma" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9NJH0	EF1G_DROME	No assigned EC number	0.3349	0.9075	0.8886	yes	no
Q6YW46	EF1G2_ORYSJ	No assigned EC number	0.7971	0.9857	0.9952	yes	no
Q6PE25	EF1G_DANRE	No assigned EC number	0.3355	0.9218	0.8800	yes	no
P26641	EF1G_HUMAN	No assigned EC number	0.3621	0.9786	0.9450	yes	no
P40921	EF1G_SCHPO	No assigned EC number	0.3251	0.9146	0.9437	yes	no
Q9ZRI7	EF1G1_ORYSJ	No assigned EC number	0.7652	0.9810	0.9904	no	no
P29547	EF1G1_YEAST	No assigned EC number	0.3219	0.8981	0.9132	yes	no
P29694	EF1G_RABIT	No assigned EC number	0.3690	0.9786	0.9450	yes	no
Q29387	EF1G_PIG	No assigned EC number	0.3675	0.9763	0.9537	yes	no
Q68FR6	EF1G_RAT	No assigned EC number	0.3667	0.9786	0.9450	yes	no
Q3SZV3	EF1G_BOVIN	No assigned EC number	0.3619	0.9786	0.9386	yes	no
Q9FUM1	EF1G_PRUAV	No assigned EC number	0.7914	1.0	1.0	N/A	no
Q5Z627	EF1G3_ORYSJ	No assigned EC number	0.7867	0.9857	1.0	no	no
Q9FVT2	EF1G2_ARATH	No assigned EC number	0.7369	0.9786	1.0	no	no
Q9D8N0	EF1G_MOUSE	No assigned EC number	0.3735	0.9786	0.9450	yes	no
A2Q127	EF1G_HORSE	No assigned EC number	0.3667	0.9786	0.9450	yes	no
O04487	EF1G1_ARATH	No assigned EC number	0.7464	0.9810	1.0	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		422
pfam00647		105	pfam00647, EF1G, Elongation factor 1 gamma, conser	1e-54
cd03181		123	cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans	2e-47
COG0625		211	COG0625, Gst, Glutathione S-transferase [Posttrans	2e-28
cd03044		75	cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu	1e-22
cd10294		123	cd10294, GST_C_ValRS_N, Glutathione S-transferase	7e-20
PLN02395		215	PLN02395, PLN02395, glutathione S-transferase	1e-14
PLN02907		722	PLN02907, PLN02907, glutamate-tRNA ligase	3e-14
pfam02798		74	pfam02798, GST_N, Glutathione S-transferase, N-ter	4e-14
cd00570		71	cd00570, GST_N_family, Glutathione S-transferase (	1e-13
PLN02473		214	PLN02473, PLN02473, glutathione S-transferase	5e-13
cd03053		76	cd03053, GST_N_Phi, GST_N family, Class Phi subfam	2e-11
cd03056		73	cd03056, GST_N_4, GST_N family, unknown subfamily	3e-11
cd00299		100	cd00299, GST_C_family, C-terminal, alpha helical d	2e-10
pfam13409		68	pfam13409, GST_N_2, Glutathione S-transferase, N-t	2e-10
cd10289		82	cd10289, GST_C_AaRS_like, Glutathione S-transferas	6e-10
cd10305		101	cd10305, GST_C_AIMP3, Glutathione S-transferase C-	8e-10
pfam13417		75	pfam13417, GST_N_3, Glutathione S-transferase, N-t	2e-09
cd03051		74	cd03051, GST_N_GTT2_like, GST_N family, Saccharomy	2e-09
cd03047		73	cd03047, GST_N_2, GST_N family, unknown subfamily	5e-09
cd03048		81	cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik	8e-09
cd03057		77	cd03057, GST_N_Beta, GST_N family, Class Beta subf	1e-08
cd03049		73	cd03049, GST_N_3, GST_N family, unknown subfamily	4e-08
cd03189		123	cd03189, GST_C_GTT1_like, C-terminal, alpha helica	4e-08
pfam00043		92	pfam00043, GST_C, Glutathione S-transferase, C-ter	9e-08
cd10309		81	cd10309, GST_C_GluProRS_N, Glutathione S-transfera	1e-07
cd03046		76	cd03046, GST_N_GTT1_like, GST_N family, Saccharomy	2e-07
PRK10542		201	PRK10542, PRK10542, glutathionine S-transferase; P	2e-07
cd03207		101	cd03207, GST_C_8, C-terminal, alpha helical domain	3e-07
TIGR01262		210	TIGR01262, maiA, maleylacetoacetate isomerase	4e-07
pfam13410		69	pfam13410, GST_C_2, Glutathione S-transferase, C-t	4e-07
cd03050		76	cd03050, GST_N_Theta, GST_N family, Class Theta su	4e-07
cd03180		110	cd03180, GST_C_2, C-terminal, alpha helical domain	6e-06
cd03045		74	cd03045, GST_N_Delta_Epsilon, GST_N family, Class	1e-05
PLN02378		213	PLN02378, PLN02378, glutathione S-transferase DHAR	3e-05
cd03043		73	cd03043, GST_N_1, GST_N family, unknown subfamily	4e-05
cd03042		73	cd03042, GST_N_Zeta, GST_N family, Class Zeta subf	4e-05
cd10308		82	cd10308, GST_C_eEF1b_like, Glutathione S-transfera	4e-05
cd03055		89	cd03055, GST_N_Omega, GST_N family, Class Omega su	5e-05
cd03182		116	cd03182, GST_C_GTT2_like, C-terminal, alpha helica	1e-04
cd10306		87	cd10306, GST_C_GluRS_N, Glutathione S-transferase	1e-04
cd03206		100	cd03206, GST_C_7, C-terminal, alpha helical domain	1e-04
cd03058		74	cd03058, GST_N_Tau, GST_N family, Class Tau subfam	2e-04
cd03178		110	cd03178, GST_C_Ure2p_like, C-terminal, alpha helic	2e-04
PRK10357		202	PRK10357, PRK10357, putative glutathione S-transfe	3e-04
PRK11752		264	PRK11752, PRK11752, putative S-transferase; Provis	6e-04
cd03188		113	cd03188, GST_C_Beta, C-terminal, alpha helical dom	7e-04
cd03198		119	cd03198, GST_C_CLIC, C-terminal, alpha helical dom	7e-04
pfam14181		155	pfam14181, YqfQ, YqfQ-like protein	7e-04
cd03190		142	cd03190, GST_C_Omega_like, C-terminal, alpha helic	0.001
cd03177		117	cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he	0.002
PRK05996		423	PRK05996, motB, flagellar motor protein MotB; Vali	0.002

>gnl\|CDD\|201369 pfam00647, EF1G, Elongation factor 1 gamma, conserved domain	Back alignment and domain information

 Score =  176 bits (448), Expect = 1e-54
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 263 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 322
           KNPLD LP S   LDEWKR YSN  T  R VA+  FW+ +DPEGYS+W+ +YKYNDE  +
Sbjct: 1   KNPLDALPKSTFNLDEWKRQYSNEDT--RTVALPYFWEHFDPEGYSIWYVEYKYNDELKL 58

Query: 323 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQE 369
            F+T N +GGF QR++ +RKYAFG + + G +    + G+W+FRGQE
Sbjct: 59  VFMTCNLIGGFFQRLEKSRKYAFGSVSVYGEDNNSDISGVWVFRGQE 105

Length = 105

>gnl\|CDD\|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins	Back alignment and domain information

>gnl\|CDD\|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>gnl\|CDD\|198327 cd10294, GST_C_ValRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of vertebrate Valyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|166036 PLN02395, PLN02395, glutathione S-transferase	Back alignment and domain information

>gnl\|CDD\|215492 PLN02907, PLN02907, glutamate-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|166114 PLN02473, PLN02473, glutathione S-transferase	Back alignment and domain information

>gnl\|CDD\|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>gnl\|CDD\|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family	Back alignment and domain information

>gnl\|CDD\|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains	Back alignment and domain information

>gnl\|CDD\|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3	Back alignment and domain information

>gnl\|CDD\|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>gnl\|CDD\|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>gnl\|CDD\|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>gnl\|CDD\|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|233333 TIGR01262, maiA, maleylacetoacetate isomerase	Back alignment and domain information

>gnl\|CDD\|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>gnl\|CDD\|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1	Back alignment and domain information

>gnl\|CDD\|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs	Back alignment and domain information

>gnl\|CDD\|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta	Back alignment and domain information

>gnl\|CDD\|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>gnl\|CDD\|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins	Back alignment and domain information

>gnl\|CDD\|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|183298 PRK11752, PRK11752, putative S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198307 cd03198, GST_C_CLIC, C-terminal, alpha helical domain of Chloride Intracellular Channels	Back alignment and domain information

>gnl\|CDD\|222581 pfam14181, YqfQ, YqfQ-like protein	Back alignment and domain information

>gnl\|CDD\|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|235665 PRK05996, motB, flagellar motor protein MotB; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		422
KOG1627		160	consensus Translation elongation factor EF-1 gamma	100.0
PF00647		107	EF1G: Elongation factor 1 gamma, conserved domain;	100.0
PLN02473		214	glutathione S-transferase	99.98
PLN02395		215	glutathione S-transferase	99.97
PRK09481		211	sspA stringent starvation protein A; Provisional	99.97
PRK13972		215	GSH-dependent disulfide bond oxidoreductase; Provi	99.97
KOG0867		226	consensus Glutathione S-transferase [Posttranslati	99.97
PRK10357		202	putative glutathione S-transferase; Provisional	99.97
PRK15113		214	glutathione S-transferase; Provisional	99.97
PRK10542		201	glutathionine S-transferase; Provisional	99.97
COG0625		211	Gst Glutathione S-transferase [Posttranslational m	99.96
TIGR01262		210	maiA maleylacetoacetate isomerase. Maleylacetoacet	99.96
PRK11752		264	putative S-transferase; Provisional	99.96
KOG0406		231	consensus Glutathione S-transferase [Posttranslati	99.95
KOG0868		217	consensus Glutathione S-transferase [Posttranslati	99.93
PLN02378		213	glutathione S-transferase DHAR1	99.93
PRK10387		210	glutaredoxin 2; Provisional	99.92
PTZ00057		205	glutathione s-transferase; Provisional	99.92
TIGR00862		236	O-ClC intracellular chloride channel protein. Thes	99.91
PLN02817		265	glutathione dehydrogenase (ascorbate)	99.91
KOG1695		206	consensus Glutathione S-transferase [Posttranslati	99.9
PLN02907		722	glutamate-tRNA ligase	99.89
TIGR02182		209	GRXB Glutaredoxin, GrxB family. This model include	99.88
KOG4420		325	consensus Uncharacterized conserved protein (Gangl	99.81
cd03181		123	GST_C_EFB1gamma GST_C family, Gamma subunit of Elo	99.6
KOG1422		221	consensus Intracellular Cl- channel CLIC, contains	99.59
cd03044		75	GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo	99.57
cd03196		115	GST_C_5 GST_C family, unknown subfamily 5; compose	99.55
PF02798		76	GST_N: Glutathione S-transferase, N-terminal domai	99.54
cd03045		74	GST_N_Delta_Epsilon GST_N family, Class Delta and	99.53
cd03182		117	GST_C_GTT2_like GST_C family, Saccharomyces cerevi	99.52
cd03048		81	GST_N_Ure2p_like GST_N family, Ure2p-like subfamil	99.52
cd03188		114	GST_C_Beta GST_C family, Class Beta subfamily; GST	99.51
cd03052		73	GST_N_GDAP1 GST_N family, Ganglioside-induced diff	99.51
cd03059		73	GST_N_SspA GST_N family, Stringent starvation prot	99.5
PF13417		75	GST_N_3: Glutathione S-transferase, N-terminal dom	99.5
cd03178		113	GST_C_Ure2p_like GST_C family, Ure2p-like subfamil	99.5
cd03189		119	GST_C_GTT1_like GST_C family, Saccharomyces cerevi	99.49
cd03060		71	GST_N_Omega_like GST_N family, Omega-like subfamil	99.48
cd03050		76	GST_N_Theta GST_N family, Class Theta subfamily; c	99.48
cd03053		76	GST_N_Phi GST_N family, Class Phi subfamily; compo	99.48
cd03041		77	GST_N_2GST_N GST_N family, 2 repeats of the N-term	99.48
cd03057		77	GST_N_Beta GST_N family, Class Beta subfamily; GST	99.47
cd03187		118	GST_C_Phi GST_C family, Class Phi subfamily; compo	99.47
cd03047		73	GST_N_2 GST_N family, unknown subfamily 2; compose	99.47
cd03056		73	GST_N_4 GST_N family, unknown subfamily 4; compose	99.47
cd03051		74	GST_N_GTT2_like GST_N family, Saccharomyces cerevi	99.46
cd03185		126	GST_C_Tau GST_C family, Class Tau subfamily; GSTs	99.45
cd03046		76	GST_N_GTT1_like GST_N family, Saccharomyces cerevi	99.45
cd03076		73	GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar	99.45
cd03186		107	GST_C_SspA GST_N family, Stringent starvation prot	99.45
cd03058		74	GST_N_Tau GST_N family, Class Tau subfamily; GSTs	99.44
cd03180		110	GST_C_2 GST_C family, unknown subfamily 2; compose	99.43
cd03049		73	GST_N_3 GST_N family, unknown subfamily 3; compose	99.43
cd03039		72	GST_N_Sigma_like GST_N family, Class Sigma_like; c	99.43
cd03055		89	GST_N_Omega GST_N family, Class Omega subfamily; G	99.43
cd03042		73	GST_N_Zeta GST_N family, Class Zeta subfamily; GST	99.43
cd03191		121	GST_C_Zeta GST_C family, Class Zeta subfamily; GST	99.43
cd03177		118	GST_C_Delta_Epsilon GST_C family, Class Delta and	99.41
cd03190		142	GST_C_ECM4_like GST_C family, ECM4-like subfamily;	99.41
cd03037		71	GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub	99.38
COG0435		324	ECM4 Predicted glutathione S-transferase [Posttran	99.37
cd03061		91	GST_N_CLIC GST_N family, Chloride Intracellular Ch	99.37
cd03183		126	GST_C_Theta GST_C family, Class Theta subfamily; c	99.36
cd03200		96	GST_C_JTV1 GST_C family, JTV-1 subfamily; composed	99.35
cd03206		100	GST_C_7 GST_C family, unknown subfamily 7; compose	99.33
PF13409		70	GST_N_2: Glutathione S-transferase, N-terminal dom	99.33
cd03207		103	GST_C_8 GST_C family, unknown subfamily 8; compose	99.33
KOG4244		281	consensus Failed axon connections (fax) protein/gl	99.32
cd03075		82	GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar	99.32
cd03077		79	GST_N_Alpha GST_N family, Class Alpha subfamily; G	99.3
cd03179		105	GST_C_1 GST_C family, unknown subfamily 1; compose	99.29
cd03043		73	GST_N_1 GST_N family, unknown subfamily 1; compose	99.27
cd03038		84	GST_N_etherase_LigE GST_N family, Beta etherase Li	99.26
cd03184		124	GST_C_Omega GST_C family, Class Omega subfamily; G	99.25
KOG3029		370	consensus Glutathione S-transferase-related protei	99.25
cd03209		121	GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar	99.24
cd00570		71	GST_N_family Glutathione S-transferase (GST) famil	99.24
cd03040		77	GST_N_mPGES2 GST_N family; microsomal Prostaglandi	99.23
COG2999		215	GrxB Glutaredoxin 2 [Posttranslational modificatio	99.22
cd03080		75	GST_N_Metaxin_like GST_N family, Metaxin subfamily	99.22
cd03203		120	GST_C_Lambda GST_C family, Class Lambda subfamily;	99.21
cd03204		111	GST_C_GDAP1 GST_C family, Ganglioside-induced diff	99.19
PF00043		95	GST_C: Glutathione S-transferase, C-terminal domai	99.19
cd03210		126	GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar	99.18
cd03195		114	GST_C_4 GST_C family, unknown subfamily 4; compose	99.17
KOG2903		319	consensus Predicted glutathione S-transferase [Pos	99.17
cd03198		134	GST_C_CLIC GST_C family, Chloride Intracellular Ch	99.15
PF13410		69	GST_C_2: Glutathione S-transferase, C-terminal dom	99.14
cd00299		100	GST_C_family Glutathione S-transferase (GST) famil	99.13
PF14497		99	GST_C_3: Glutathione S-transferase, C-terminal dom	99.11
cd03208		137	GST_C_Alpha GST_C family, Class Alpha subfamily; G	99.06
cd03054		72	GST_N_Metaxin GST_N family, Metaxin subfamily; com	99.03
cd03201		121	GST_C_DHAR GST_C family, Dehydroascorbate Reductas	99.0
cd03192		104	GST_C_Sigma_like GST_C family, Class Sigma_like; c	98.97
cd03194		114	GST_C_3 GST_C family, unknown subfamily 3; compose	98.95
cd03205		98	GST_C_6 GST_C family, unknown subfamily 6; compose	98.92
KOG3027		257	consensus Mitochondrial outer membrane protein Met	98.88
cd03193		88	GST_C_Metaxin GST_C family, Metaxin subfamily; com	98.81
KOG3028		313	consensus Translocase of outer mitochondrial membr	98.78
cd03079		74	GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me	98.75
cd03202		124	GST_C_etherase_LigE GST_C family, Beta etherase Li	98.7
cd03212		137	GST_C_Metaxin1_3 GST_C family, Metaxin subfamily,	98.44
KOG1147		712	consensus Glutamyl-tRNA synthetase [Translation, r	98.39
cd03211		126	GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me	98.37
cd03197		149	GST_C_mPGES2 GST_C family; microsomal Prostaglandi	98.3
PF14834		117	GST_C_4: Glutathione S-transferase, C-terminal dom	98.23
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	98.18
cd03078		73	GST_N_Metaxin1_like GST_N family, Metaxin subfamil	98.14
PRK10638		83	glutaredoxin 3; Provisional	98.01
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	97.8
PRK10329		81	glutaredoxin-like protein; Provisional	97.62
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	97.52
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	97.52
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	97.52
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	97.47
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	97.21
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	97.19
COG0695		80	GrxC Glutaredoxin and related proteins [Posttransl	97.17
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	97.03
PRK11200		85	grxA glutaredoxin 1; Provisional	96.92
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	96.91
PF10568		72	Tom37: Outer mitochondrial membrane transport comp	96.52
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	95.9
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	95.81
PF04399		132	Glutaredoxin2_C: Glutaredoxin 2, C terminal domain	95.61
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	95.53
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	95.51
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	94.78
KOG1668		231	consensus Elongation factor 1 beta/delta chain [Tr	94.34
cd03199		128	GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub	94.26
PHA03050		108	glutaredoxin; Provisional	94.1
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	93.09
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	93.01
COG1393		117	ArsC Arsenate reductase and related proteins, glut	92.48
COG4545		85	Glutaredoxin-related protein [Posttranslational mo	92.27
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	91.29
cd03032		115	ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub	91.0
PRK01655		131	spxA transcriptional regulator Spx; Reviewed	90.74
cd03031		147	GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d	89.91
PRK10026		141	arsenate reductase; Provisional	89.39
PRK13344		132	spxA transcriptional regulator Spx; Reviewed	89.36
PF09635		122	MetRS-N: MetRS-N binding domain; InterPro: IPR0182	88.44
cd03036		111	ArsC_like Arsenate Reductase (ArsC) family, unknow	87.93
PRK10853		118	putative reductase; Provisional	87.9
PRK12559		131	transcriptional regulator Spx; Provisional	87.86
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	87.68
cd02977		105	ArsC_family Arsenate Reductase (ArsC) family; comp	87.22
TIGR01617		117	arsC_related transcriptional regulator, Spx/MgsR f	84.88
cd03033		113	ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p	83.82
cd03035		105	ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s	83.44
PF05768		81	DUF836: Glutaredoxin-like domain (DUF836); InterPr	83.08

>KOG1627 consensus Translation elongation factor EF-1 gamma [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=1.5e-77  Score=502.35  Aligned_cols=156  Identities=51%  Similarity=0.949  Sum_probs=151.6

Q ss_pred             CCCCCCCCCCCchhhHhhhhcCCCccchhhhhhhhhhccCCCCcEEEEEeeccCCCccceeecchhhhHHHHhhhhhhhh
Q 014592          264 NPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKY  343 (422)
Q Consensus       264 ~pl~~lp~~~f~ld~~kr~ysn~~~~~~~~~~~~fw~~~d~~~~s~w~~~yky~~e~~~~fm~~nli~gf~qr~~~~~k~  343 (422)
                      |||++||+|+|+||||||+|||+||  +.+||||||+||||||||||+|+||||+||+++||||||||||||||+++|||
T Consensus         1 ~pl~~lp~~~Fvldd~kr~ySn~dt--~~~a~P~f~e~~d~e~ys~w~~~Yky~eeL~~~fms~nli~g~~qrl~~~rk~   78 (160)
T KOG1627|consen    1 DPLDLLPKSTFVLDDWKRKYSNEDT--REVALPWFWEHFDPEGYSLWKVDYKYNEELTLTFMSCNLIGGFFQRLDKSRKY   78 (160)
T ss_pred             CchhhCCCCccchhhhhhhhccccc--ccccchHHHHHhCcccceeeeccccCchHHHHHHHHhhhhhHHHHHHHHHHHh
Confidence            7999999999999999999999999  78999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEeecCCCceeEEEEEEeCCCCCcccc--ccCCCcCceeeEecCCCCHHHHHHHHHHhccCCCCC--Cccccccc
Q 014592          344 AFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIM--DECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAK  419 (422)
Q Consensus       344 ~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~--~~~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~~~--g~~~~~~k  419 (422)
                      +||||+|+|+|++++|+|+|+|||||+.+ .|  |++||||||+||||||+++|+|++|++||+|+++++  ||.++|||
T Consensus        79 ~f~~~~~~g~~~~~~i~g~~~~rg~ela~-~~spDwq~D~EsY~~tKLD~~see~k~~V~ey~sWeg~f~~~Gkaf~qgK  157 (160)
T KOG1627|consen   79 AFGSMVLFGENGNSTISGAWVFRGQELAP-AFSPDWQPDYESYTWTKLDPGSEETKELVNEYFSWEGPFEGNGKAFNDGK  157 (160)
T ss_pred             hheeEEEeccCCCCcceEEEEEecccccc-ccCccccccccceeeeecCCCCHHHHHHHHHHHhhcccccccchhhhccc
Confidence            99999999999999999999999999755 77  999999999999999999999999999999999755  69999999


Q ss_pred             ccC
Q 014592          420 CFK  422 (422)
Q Consensus       420 ~~k  422 (422)
                      |||
T Consensus       158 i~K  160 (160)
T KOG1627|consen  158 IFK  160 (160)
T ss_pred             ccC
Confidence            998

>PF00647 EF1G: Elongation factor 1 gamma, conserved domain; InterPro: IPR001662 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>PLN02473 glutathione S-transferase	Back alignment and domain information

>PLN02395 glutathione S-transferase	Back alignment and domain information

>PRK09481 sspA stringent starvation protein A; Provisional	Back alignment and domain information

>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10357 putative glutathione S-transferase; Provisional	Back alignment and domain information

>PRK15113 glutathione S-transferase; Provisional	Back alignment and domain information

>PRK10542 glutathionine S-transferase; Provisional	Back alignment and domain information

>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01262 maiA maleylacetoacetate isomerase	Back alignment and domain information

>PRK11752 putative S-transferase; Provisional	Back alignment and domain information

>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02378 glutathione S-transferase DHAR1	Back alignment and domain information

>PRK10387 glutaredoxin 2; Provisional	Back alignment and domain information

>PTZ00057 glutathione s-transferase; Provisional	Back alignment and domain information

>TIGR00862 O-ClC intracellular chloride channel protein	Back alignment and domain information

>PLN02817 glutathione dehydrogenase (ascorbate)	Back alignment and domain information

>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>TIGR02182 GRXB Glutaredoxin, GrxB family	Back alignment and domain information

>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]	Back alignment and domain information

>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A	Back alignment and domain information

>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs	Back alignment and domain information

>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins	Back alignment and domain information

>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha	Back alignment and domain information

>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4	Back alignment and domain information

>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins	Back alignment and domain information

>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene	Back alignment and domain information

>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B	Back alignment and domain information

>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms]	Back alignment and domain information

>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs	Back alignment and domain information

>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only]	Back alignment and domain information

>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs	Back alignment and domain information

>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs	Back alignment and domain information

>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins	Back alignment and domain information

>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B	Back alignment and domain information

>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B	Back alignment and domain information

>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant	Back alignment and domain information

>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha	Back alignment and domain information

>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins	Back alignment and domain information

>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription]	Back alignment and domain information

>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes	Back alignment and domain information

>PRK01655 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs	Back alignment and domain information

>PRK10026 arsenate reductase; Provisional	Back alignment and domain information

>PRK13344 spxA transcriptional regulator Spx; Reviewed	Back alignment and domain information

>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS)	Back alignment and domain information

>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC	Back alignment and domain information

>PRK10853 putative reductase; Provisional	Back alignment and domain information

>PRK12559 transcriptional regulator Spx; Provisional	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx	Back alignment and domain information

>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family	Back alignment and domain information

>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC	Back alignment and domain information

>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC	Back alignment and domain information

>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		422
1pbu_A		162	Solution Structure Of The C-Terminal Domain Of The		6e-21
1aw9_A		216	Structure Of Glutathione S-Transferase Iii In Apo F		3e-11
3m8n_A		225	Crystal Structure Of A Possible Gutathione S-Tranfe		3e-09
1bye_A		213	Glutathione S-Transferase I From Mais In Complex Wi		1e-08
1axd_A		209	Structure Of Glutathione S-transferase-i Bound With		2e-08
1nhy_A		219	Crystal Structure Of The Gst-Like Domain Of Elongat		1e-07
4iel_A		229	Crystal Structure Of A Glutathione S-Transferase Fa		2e-07
3erf_A		233	Crystal Structure Of Gtt2 From Saccharomyces Cerevi		3e-07
1jlv_A		209	Anopheles Dirus Species B Glutathione S-transferase		2e-05
4hz2_A		230	Crystal Structure Of Glutathione S-Transferase Xaut		2e-05
2uz8_A		174	The Crystal Structure Of P18, Human Translation Elo		3e-05
3uap_A		227	Crystal Structure Of Glutathione Transferase (Targe		5e-05
3f6f_A		210	Crystal Structure Of Glutathione Transferase Dmgstd		5e-05
3lxz_A		229	Structure Of Probable Glutathione S-Transferase(Pp0		7e-05
2dsa_A		203	Ternary Complex Of Bphk, A Bacterial Gst Length = 2		9e-05
2gdr_A		202	Crystal Structure Of A Bacterial Glutathione Transf		9e-05
4iq1_A		231	Crystal Structure Of Glutathione S-transferase Mha_		1e-04
4glt_A		225	Crystal Structure Of Glutathione S-Transferase Mfla		1e-04
2x64_A		207	Glutathione-S-Transferase From Xylella Fastidiosa L		2e-04
2vo4_A		219	Glutathione Transferase From Glycine Max Length = 2		2e-04
2pmt_A		203	Glutathione Transferase From Proteus Mirabilis Leng		2e-04
4j2f_A		223	Crystal Structure Of A Glutathione Transferase Fami		5e-04
1gnw_A		211	Structure Of Glutathione S-Transferase Length = 211		6e-04
3ein_A		209	Delta Class Gst Length = 209		7e-04
3vwx_A		222	Structural Analysis Of An Epsilon-class Glutathione		7e-04

>pdb|1PBU|A Chain A, Solution Structure Of The C-Terminal Domain Of The Human Eef1bgamma Subunit Length = 162