Citrus Sinensis ID: 014613

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-

MEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIALVQQFVRPENLDIKASFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIALNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAESFISNIDAQALSMEESEFERNMESAQALLSGLSADMDGLSNQNDESEGQISVEQLIQSKHQGVNSTKEKEHLTPVRSSESKSVKKVTFAKDQEPITKVPSLSELENKGATMLLKEEKASQVFQEYPYLFAQVGDLTISDVEDLLNNYKQLVFKYVCLSKGLGSAASSLPSSVLPSQVQLQVETMKAPEEHKRVELNDESEKDTSETNDSSNQVLNSNEEKVESQLPEDEEKVERGGKNDETSK

cHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccc

***A*R*HPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIALVQQFVRPENLDIKASFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIALNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAESFISNIDA**************************************************************************************************************SQVFQEYPYLFAQVGDLTISDVEDLLNNYKQLVFKYVCLSKGL**********************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEAAFRAHPLWAGCSEEELDSAGEGLEKYVMTKLFTRVFASIPDDVKTDEQLSEKIALVQQFVRPENLDIKASFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIALNENPPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRQSRLVGEAAYFFTNMLSAESFISNIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNDESEGQISVEQLIQSKHQGVNSTKEKEHLTPVRSSESKSVKKVTFAKDQEPITKVPSLSELENKGATMLLKEEKASQVFQEYPYLFAQVGDLTISDVEDLLNNYKQLVFKYVCLSKGLGSAASSLPSSVLPSQVQLQVETMKAPEEHKRVELNDESEKDTSETNDSSNQVLNSNEEKVESQLPEDEEKVERGGKNDETSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 9A	Functions as guanine nucleotide exchange factor (GEF) for Rab small GTPases. Activates specifically RABF1, RABF2A and RABF2B proteins. Required for early stages of embryogenesis, cytokinesis, embryogenesis, and organ development. Is essential for the establishment or maintenance of the polar localization of the auxin efflux carrier PIN1.	probable	Q9LT31

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EFE, chain A
Confidence level:very confident
Coverage over the Query: 1-206
View the alignment between query and template
View the model in PyMOL