Citrus Sinensis ID: 014616


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MALVGAIVGAASGGWINDAYGRKKATLLADVVFTAGAIIMAAAPDPYVLILGRLLVGLGVGIASVTAPVYIAEASPSEVRGGLVSTNVLMITSGQFLSYLVNLAFTEVPGTWRWMLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDIARLEDEIDHLSAAAEEELRKKKTVRYLDVFKSKEIRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFQSNQLALLLSLAVAGTNAVGTIVGIYLIDHFGRKKLALSSLAGVIISLVLLSWAFISGSSASSSGVYGWIAVIGLALYIAFFAPGMGPVPWTLNSEVYPEQYRGICGGMSATVNWISNLIVAQTFLTVAELVGTGATFLILAGIAVLAVVFVILFVPETQGLTFLEVEQMWKERAWGSSLNTESLLEHGNSS
cHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHccccc
MALVGAIVGAASGGWINDAYGRKKATLLADVVFTAGAIIMAAAPDPYVLILGRLLVGLGVGIASVTAPVYIAEASPSEVRGGLVSTNVLMITSGQFLSYLVNLAFTEVPGTWRWMLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDIARLEDEIDHLSAAAEEELRKKKTVRYLDVFKSKEIRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFQSNQLALLLSLAVAGTNAVGTIVGIYLIDHFGRKKLALSSLAGVIISLVLLSWAFISGSSASSSGVYGWIAVIGLALYIAFFAPGMGPVPWTLNSEVYPEQYRGICGGMSATVNWISNLIVAQTFLTVAELVGTGATFLILAGIAVLAVVFVILFVPETQGLTFLEVEQMWKERA*****************
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVGAIVGAASGGWINDAYGRKKATLLADVVFTAGAIIMAAAPDPYVLILGRLLVGLGVGIASVTAPVYIAEASPSEVRGGLVSTNVLMITSGQFLSYLVNLAFTEVPGTWRWMLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDxxxxxxxxxxxxxxxxxxxxxKKTVRYLDVFKSKEIRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFQSNQLALLLSLAVAGTNAVGTIVGIYLIDHFGRKKLALSSLAGVIISLVLLSWAFISGSSASSSGVYGWIAVIGLALYIAFFAPGMGPVPWTLNSEVYPEQYRGICGGMSATVNWISNLIVAQTFLTVAELVGTGATFLILAGIAVLAVVFVILFVPETQGLTFLEVEQMWKERAWGSSLNTESLLEHGNSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inositol transporter 1 Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles. Not involved in glucose or fructose transport.confidentQ8VZR6
Galactose-proton symporter Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system).probableP0AEP2
Putative metabolite transport protein YwtG probableC0SPB2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 15-401
View the alignment between query and template
View the model in PyMOL