Citrus Sinensis ID: 014619


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MSGELDDDVEAEQTISINEYLNDVEEKELEADLVLGGDEGKECTYSKGYMKRQAIFSCLSCAPEGNAGVCTACSLTCHDGHEIVELWTKRNFRCDCGNSKFGEFFCKLFPSKDVENAENSYNHNFKGVYCTCNRPYPDPDVEEQVEMIQCCICEDWFHEEHIGLEPSDEIPRDDEGEPVYEDFICKACSAVCSFLSTYPQTIWAAGLRRNAGCNTNKDKDVLEEIPSAGGSGKLENGICSNGSPREDNAIANTSAESVTGGKGVTGESSKKIFDLVQCMNDGGAHIACLFGDNIVVDGSISLTKPLFLSKNWRATLCRCKKCLSMYEQKRVPYLIDEEDSIAEYERTAKQKREEKLQQQEGAELTFLNKLGHVEKMEILNGIADMKDEFHNFLQSFDPSKAITSDDVHQIFENLAKKRRRE
ccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEcccccccccccccccHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcc
****************INEYLNDVEEKELEADLVLGGDEGKECTYSKGYMKRQAIFSCLSCAPEGNAGVCTACSLTCHDGHEIVELWTKRNFRCDCGNSKFGEFFCKLFPSKDVENAENSYNHNFKGVYCTCNRPYPDPDVEEQVEMIQCCICEDWFHEEHIGL**********EGEPVYEDFICKACSAVCSFLSTYPQTIWAAGLRRNAG*************************************************************************************GSISLTKPLFLSKNWRATLCRCKKCLSMYEQKRVPYLIDEED************************LTFLNKLGHVEKMEILNGIADMKDEFHNFLQSFDPSKAITSDDVHQIF**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGELDDDVEAEQTISINEYLNDVEEKELEADLVLGGDEGKECTYSKGYMKRQAIFSCLSCAPEGNAGVCTACSLTCHDGHEIVELWTKRNFRCDCGNSKFGEFFCKLFPSKDVENAENSYNHNFKGVYCTCNRPYPDPDVEEQVEMIQCCICEDWFHEEHIGLEPSDEIPRDDEGEPVYEDFICKACSAVCSFLSTYPQTIWAAGLRRNAGCNTNKDKDVLEEIPSAGGSGKLENGICSNGSPREDNAIANTSAESVTGGKGVTGESSKKIFDLVQCMNDGGAHIACLFGDNIVVDGSISLTKPLFLSKNWRATLCRCKKCLSMYEQKRVPYxxxxxxxxxxxxxxxxxxxxxxxxxxxxAELTFLNKLGHVEKMEILNGIADMKDEFHNFLQSFDPSKAITSDDVHQIFENLAKKRRRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative E3 ubiquitin-protein ligase UBR7 E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.probableQ8N806
Putative E3 ubiquitin-protein ligase UBR7 E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.probableQ8BU04

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WEP, chain A
Confidence level:confident
Coverage over the Query: 118-199
View the alignment between query and template
View the model in PyMOL
Template: 3NY3, chain A
Confidence level:confident
Coverage over the Query: 52-103
View the alignment between query and template
View the model in PyMOL