Citrus Sinensis ID: 014650

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-

MPPSSLRQQQLVATDETVTLIPGLPNDVASLILAFVPYSHQSRLKQTCRSWFLFFSSRTLVFDRHKFNSQSDLLCIFPQDPSISSPFLFDAANRACRPLPPLPCNPSTYSLCNFTSISLGPYIYLLGGSHFDARSFPLDRPLPSDSAFRFNFLTFSWERIAPMISPRGSFACAAVRSLNQIIVAGGGSRHSLFGAAGSRISSVERYDVAKNEWVSMDEMPRFRAGCVGFVAEESGEFWVMGGYGDSRTISGVLPVDEYYRDAVVMQLKKKKKTDDHDDGDRGTWREVGDMWDEWERSRIGKIVVMEDENRGRPEVFMLDKFDILRYDMGLNRWLKETTIPEIRPCKKPLGFIVLDGELYVMTVLKGSDLNETRRSQQHKRAGCLFIQIYHPRKKTWRYIFTKPPFPQPLDFGTAIMCTVRL

cccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHcHHHHHHHccccHHHHHHHccccccEEEEEEcccccccEEEECcccccccccccccccccccccccCEEEEEccEEEEEcccccccccccccccccccEEEEECcccccCECcccccccccccEEEEEccccEEEEEEccccccccccccccccEEEEECcccccEEEccccccccccccEEEEEEccEEEEEEccccccccccccccccccHHHHHHHHHccccccEEECcccccEEECcccccccccccccEEEEEEECccccccCCcccccEEEEEEcccccEEEECcccccccccccCEEEEEccEEEEEEcccccccccccHcccccccccEEEEEEccccccCEEEcccccccccccccCEEEEEEEc

******************TLIPGLPNDVASLILAFVPYSHQSRLKQTCRSWFLFFSSRTLVFDRHKFNSQSDLLCIFPQDPSISSPFLFDAANRACRPLPPLPCNPSTYSLCNFTSISLGPYIYLLGGSHFDARSFPLDRPLPSDSAFRFNFLTFSWERIAPMISPRGSFACAAVRSLNQIIVAGGGSRHSLFGAAGSRISSVERYDVAKNEWVSMDEMPRFRAGCVGFVAEESGEFWVMGGYGDSRTISGVLPVDEYYRDAVVMQLKKKKKTDDHDDGDRGTWREVGDMWDEWERSRIGKIVVMEDENRGRPEVFMLDKFDILRYDMGLNRWLKETTIPEIRPCKKPLGFIVLDGELYVMTVLKGSDLNETRRSQQHKRAGCLFIQIYHPRKKTWRYIFTKPPFPQPLDFGTAIMCTVRL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box/kelch-repeat protein OR23		probable	Q0V7S6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ASC, chain A
Confidence level:very confident
Coverage over the Query: 71-270,283-420
View the alignment between query and template
View the model in PyMOL

Template: 3II7, chain A
Confidence level:very confident
Coverage over the Query: 39-247,258-270,283-356
View the alignment between query and template
View the model in PyMOL

Template: 2UVK, chain A
Confidence level:very confident
Coverage over the Query: 98-130,144-265,278-417
View the alignment between query and template
View the model in PyMOL

Template: 2E31, chain A
Confidence level:probable
Coverage over the Query: 39-66
View the alignment between query and template
View the model in PyMOL