Citrus Sinensis ID: 014661

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MEPENVPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
cccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccEEEEEEEEccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEcccEEEccEEEEEccccccccccccccEEEEEEccccccccccccEEEEEEEEEEccccccccccccccEEEEEEEEEEcccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEcccccEEEcccccHHHHHHHHHHHHHcccEEccccccccccccEEEEEEEcccEEEcccEEEEEcccEEEcccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHcHHHHHHHccEEEEEcccccccccccccccHHHccHHHHccEEEEcEEEEEccccccEEEEEEEEccccccEEcccccccccccEEcccccccccccccccccEEEEcccEEEEcEEEEEEEEcccccccccccccEEEEEcHHHHHccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHccHHHHHHHHHHHHHcccccccccccEEEccEEEEEEccccccHHHHHHHHHHHcccEEEEccccccccEEEEEEEEccccEEEEccHEEEEcccEEEEEcccc
MEPENVPAHLKALAEFVIRHhsdqlrsitlspdpklhyplyidfaelldedpeiahlvfskpadylRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRinvsgsplecpetfpsigrvrvKHHGVLLTLKGTVIRSGATKMYEGERTYMCRkckhmfpvypeletrnsivlpshcpsqrskpcegtnfqfvENSIICHDYQEIKIQEStqvlgvgviprSILVILKDDLVDIVKAGDDVIVTGILtakwspdlkdvrcdldpvlianhvrrtnelksdidipdDIIMQFKQFWSEfkdtplkgrnailrgicpqvFGLFTVKLAVALTLIGGvqhvdasgtkvrgeshlllvgdpgtgkSQFLKFAAKLSNRSVIttglgstsaglTVTAVKDGGEWMLEAGALVLAdgglccidefdr
MEPENVPAHLKALAEFVIRHHSDQLRSitlspdpklHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIhvrinvsgsplecpETFPSIGRVRVKHHgvlltlkgtvirsgatkmYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGiltakwspdlkdvRCDLDPVlianhvrrtnelksdidipdDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVIttglgstsaglTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
MEPENVPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVIttglgstsagltvtAVKDGGEWMLEAGALVLADGGLCCIDEFDR
*********LKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHC*******CEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDE***
*****VPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVF*************FIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELET*NSIV*****************FQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWS*****VRCDLDPVLIANHVRR****************QFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
********HLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
MEPENVPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPENVPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
F1N2W9 1139 DNA helicase MCM9 OS=Bos yes no 0.938 0.345 0.474 1e-104
Q6NRM6 1143 DNA helicase MCM9 OS=Xeno N/A no 0.938 0.344 0.481 1e-104
F6RIX4 1117 DNA helicase MCM9 OS=Xeno yes no 0.973 0.366 0.467 1e-103
Q9NXL9 1143 DNA helicase MCM9 OS=Homo yes no 0.95 0.349 0.474 1e-103
Q2KHI9 1134 DNA helicase MCM9 OS=Mus yes no 0.973 0.360 0.473 1e-103
I0IUP4 1169 DNA helicase MCM9 OS=Gall yes no 0.945 0.339 0.481 1e-103
F1QDI9 1133 DNA helicase MCM9 OS=Dani yes no 0.95 0.352 0.476 1e-103
F1M5F3 1124 DNA helicase MCM9 OS=Ratt yes no 0.973 0.363 0.473 1e-102
Q9UXG1 686 Minichromosome maintenanc yes no 0.852 0.521 0.328 4e-43
P49736 904 DNA replication licensing no no 0.833 0.387 0.328 2e-42
>sp|F1N2W9|MCM9_BOVIN DNA helicase MCM9 OS=Bos taurus GN=MCM9 PE=3 SV=2 Back     alignment and function desciption
 Score =  377 bits (969), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/411 (47%), Positives = 264/411 (64%), Gaps = 17/411 (4%)

Query: 16  FVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIW 75
           +V  +H + +  I    D   HYP+ ++   L + + EI     + P + L  F++A   
Sbjct: 16  YVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNAFPNEVLTIFDNALRR 75

Query: 76  AHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPET----FPSIGRVRVKHHGVLLTLK 131
           +   +   L   E    K+ +H RI  SG P+ CPE      P     + K  G  L++ 
Sbjct: 76  SALTILQSLSQPEGLSMKQNLHARI--SGLPV-CPELVREHIP-----KTKDVGHFLSVT 127

Query: 132 GTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQF 191
           GTVIR+   K+ E ER YMC KCKH+F V  + E   +   PS CPS  +  C+ + F  
Sbjct: 128 GTVIRTSLVKILEFERDYMCNKCKHVFVVQADFEQYYTFFRPSSCPSLEN--CDSSKFTC 185

Query: 192 VEN---SIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTA 248
           + +      C DYQEIKIQE  Q L VG IPRS+ VIL+DDLVD  K+GDD+ + G++  
Sbjct: 186 LSDLSSPTRCRDYQEIKIQEQVQRLSVGSIPRSMQVILEDDLVDSCKSGDDITIYGVVMQ 245

Query: 249 KWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAI 308
           +W P  +DVRC+++ VL AN+++  NE  + +++ +++  +F+ FW  +K  P  GRN I
Sbjct: 246 RWKPFKQDVRCEVEIVLKANYIQVNNEESAGVNMDEEVRKEFEDFWEHYKSDPFAGRNEI 305

Query: 309 LRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAA 368
           L  +CPQVFG++ VKLAVA+ L GG+Q  DA+GT+VRGESHLLLVGDPGTGKSQFLK+AA
Sbjct: 306 LASLCPQVFGMYLVKLAVAMVLAGGIQRTDATGTRVRGESHLLLVGDPGTGKSQFLKYAA 365

Query: 369 KLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFD 419
           K++ RSV+TTG+GSTSAGLTVTAVKD GEW LEAGALVLAD GLCCIDEF+
Sbjct: 366 KITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGALVLADAGLCCIDEFN 416
Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6NRM6|MCM9_XENLA DNA helicase MCM9 OS=Xenopus laevis GN=mcm9 PE=1 SV=1 Back     alignment and function description
>sp|F6RIX4|MCM9_XENTR DNA helicase MCM9 OS=Xenopus tropicalis GN=mcm9 PE=3 SV=1 Back     alignment and function description
>sp|Q9NXL9|MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens GN=MCM9 PE=1 SV=4 Back     alignment and function description
>sp|Q2KHI9|MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus GN=Mcm9 PE=1 SV=2 Back     alignment and function description
>sp|I0IUP4|MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus GN=MCM9 PE=1 SV=2 Back     alignment and function description
>sp|F1QDI9|MCM9_DANRE DNA helicase MCM9 OS=Danio rerio GN=mcm9 PE=2 SV=2 Back     alignment and function description
>sp|F1M5F3|MCM9_RAT DNA helicase MCM9 OS=Rattus norvegicus GN=Mcm9 PE=3 SV=2 Back     alignment and function description
>sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 Back     alignment and function description
>sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens GN=MCM2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
449438564 649 PREDICTED: DNA helicase MCM9-like [Cucum 0.976 0.631 0.839 0.0
255569722 644 Minichromosome maintenance protein MCM, 0.983 0.641 0.837 0.0
224145770 738 predicted protein [Populus trichocarpa] 0.995 0.566 0.813 0.0
356557569 634 PREDICTED: DNA replication licensing fac 0.969 0.641 0.813 0.0
186500321 646 minichromosome maintenance 9 [Arabidopsi 0.992 0.645 0.776 0.0
297831874 661 minichromosome maintenance family protei 0.990 0.629 0.780 0.0
296088390 665 unnamed protein product [Vitis vinifera] 0.973 0.615 0.803 0.0
225427401 644 PREDICTED: DNA replication licensing fac 0.973 0.635 0.803 0.0
4388832 610 putative DNA replication licensing facto 0.992 0.683 0.761 0.0
218197811 674 hypothetical protein OsI_22179 [Oryza sa 0.969 0.603 0.717 1e-171
>gi|449438564|ref|XP_004137058.1| PREDICTED: DNA helicase MCM9-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/410 (83%), Positives = 376/410 (91%)

Query: 10  LKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFF 69
           LKA A F+IRHHSDQLRSI  SPDPKLHYPL+++FAEL+D+DP +A L+FS+P DYLR F
Sbjct: 16  LKAFATFLIRHHSDQLRSIAHSPDPKLHYPLFVEFAELMDDDPPLARLLFSRPTDYLRVF 75

Query: 70  EDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLT 129
           +DAA+WAH I+  + K     V+K FIHVRINV+GSPLE PETFPSIG VRVKHHGVLLT
Sbjct: 76  DDAAVWAHMIILGDSKGSMNGVKKDFIHVRINVTGSPLEFPETFPSIGSVRVKHHGVLLT 135

Query: 130 LKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNF 189
           LKGTVIRSGA KMYEGER Y+CRKCKH FPVYPELETRNSI LPS CPSQRSKPCEG +F
Sbjct: 136 LKGTVIRSGAIKMYEGERWYICRKCKHKFPVYPELETRNSIQLPSFCPSQRSKPCEGKSF 195

Query: 190 QFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAK 249
           + +E S++ HDYQEIKIQESTQVLGVG IPRS+L+ILKDDLVD+VKAGDDVIV+G+L+AK
Sbjct: 196 ECLEGSVVRHDYQEIKIQESTQVLGVGSIPRSVLIILKDDLVDLVKAGDDVIVSGVLSAK 255

Query: 250 WSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAIL 309
           WSPDLKDVRCDLDP+LIANHVRRTNELK+++DIPDDIIMQF QFWS+FKDTPLKGRNAIL
Sbjct: 256 WSPDLKDVRCDLDPMLIANHVRRTNELKAEVDIPDDIIMQFTQFWSDFKDTPLKGRNAIL 315

Query: 310 RGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAK 369
           RGICPQVFGLFTVKLAVALTLIGGVQHVD SGTKVRGESHLLLVGDPGTGKSQFLKFAAK
Sbjct: 316 RGICPQVFGLFTVKLAVALTLIGGVQHVDISGTKVRGESHLLLVGDPGTGKSQFLKFAAK 375

Query: 370 LSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCIDEFD 419
           LSNRSVITTGLGSTSAGLTV AVKDGGEWMLEAGALVLADGGLCCIDE D
Sbjct: 376 LSNRSVITTGLGSTSAGLTVAAVKDGGEWMLEAGALVLADGGLCCIDEVD 425

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255569722|ref|XP_002525825.1| Minichromosome maintenance protein MCM, putative [Ricinus communis] gi|223534830|gb|EEF36519.1| Minichromosome maintenance protein MCM, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145770|ref|XP_002325759.1| predicted protein [Populus trichocarpa] gi|222862634|gb|EEF00141.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356557569|ref|XP_003547088.1| PREDICTED: DNA replication licensing factor MCM9-like [Glycine max] Back     alignment and taxonomy information
>gi|186500321|ref|NP_179021.3| minichromosome maintenance 9 [Arabidopsis thaliana] gi|330251181|gb|AEC06275.1| minichromosome maintenance 9 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831874|ref|XP_002883819.1| minichromosome maintenance family protein [Arabidopsis lyrata subsp. lyrata] gi|297329659|gb|EFH60078.1| minichromosome maintenance family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296088390|emb|CBI37381.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427401|ref|XP_002263738.1| PREDICTED: DNA replication licensing factor MCM9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|4388832|gb|AAD19787.1| putative DNA replication licensing factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|218197811|gb|EEC80238.1| hypothetical protein OsI_22179 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
TAIR|locus:2053448 646 MCM9 "minichromosome maintenan 0.997 0.648 0.742 1.2e-170
ZFIN|ZDB-GENE-041014-310 1135 mcm9 "minichromosome maintenan 0.985 0.364 0.441 4.5e-91
UNIPROTKB|I0IUP4 1169 MCM9 "DNA helicase MCM9" [Gall 0.942 0.338 0.458 2.8e-89
UNIPROTKB|F1N2W9 1139 MCM9 "DNA helicase MCM9" [Bos 0.983 0.362 0.433 1.2e-88
UNIPROTKB|J9PA91 1141 MCM9 "Uncharacterized protein" 0.983 0.361 0.439 1.6e-88
UNIPROTKB|Q6NRM6 1143 mcm9 "DNA helicase MCM9" [Xeno 0.938 0.344 0.450 1.6e-88
UNIPROTKB|Q9NXL9 1143 MCM9 "DNA helicase MCM9" [Homo 0.983 0.361 0.439 2e-88
UNIPROTKB|F6RIX4 1117 mcm9 "DNA helicase MCM9" [Xeno 0.973 0.366 0.443 2.5e-88
MGI|MGI:1918817 1134 Mcm9 "minichromosome maintenan 0.983 0.364 0.444 2.5e-88
UNIPROTKB|F1SF38 1126 MCM9 "Uncharacterized protein" 0.983 0.366 0.439 3.2e-88
TAIR|locus:2053448 MCM9 "minichromosome maintenance 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1659 (589.1 bits), Expect = 1.2e-170, P = 1.2e-170
 Identities = 314/423 (74%), Positives = 361/423 (85%)

Query:     1 ME-PENVPAHLKALAEFVIRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVF 59
             ME P     H++++ EF+++H+ DQLR I+LS DPKLHYPL+I++AEL+D++P +A  VF
Sbjct:     1 MESPTQTSEHIESMTEFLVKHYPDQLREISLSSDPKLHYPLFIEYAELVDDNPSLARQVF 60

Query:    60 SKPADYLRFFEDAAIWAHKIVFDELKSCEKRV--EKKFIHVRINVSGSPLE-CPETFPSI 116
             S P  YLR F+D+AI AHKI  + +K  E+++  EK+FIHVRIN SGSPLE  PETFPSI
Sbjct:    61 SDPEHYLRQFDDSAILAHKIALEHMKKFEEKIGIEKRFIHVRINTSGSPLERSPETFPSI 120

Query:   117 GRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHC 176
             GRVRVKH G+L+ LKGTVIRSGA KMYEGE+ Y CRKCKHMFP++PELE+ NSIV P  C
Sbjct:   121 GRVRVKHRGILMMLKGTVIRSGAVKMYEGEKMYRCRKCKHMFPIFPELESINSIVKPPFC 180

Query:   177 PSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKA 236
             PSQRSK CEGTNF  V++++  HDYQEIKIQE+TQVLGVGVIPRSILV+LKDDLVD VKA
Sbjct:   181 PSQRSKACEGTNFDPVDDTVTRHDYQEIKIQENTQVLGVGVIPRSILVVLKDDLVDNVKA 240

Query:   237 GDDVIVTGILTAKWSPDLKDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSE 296
             GDDV+V+GILT+KWS DLKDVRCDL+P+LIANHVRRTNELKS+IDI DD+I +FK FWS 
Sbjct:   241 GDDVVVSGILTSKWSHDLKDVRCDLEPMLIANHVRRTNELKSEIDISDDLIEKFKNFWSH 300

Query:   297 FKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDP 356
             F+DTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLL+GDP
Sbjct:   301 FRDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLIGDP 360

Query:   357 GTGKSQFLKFAAKLSNRSVIXXXXXXXXXXXXXXAVKDGGEWMLEAGALVLADGGLCCID 416
             GTGKSQFLKFAAKLSNR+VI              AVKDGGEWMLEAGALVLADGGLCCID
Sbjct:   361 GTGKSQFLKFAAKLSNRAVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCID 420

Query:   417 EFD 419
             EFD
Sbjct:   421 EFD 423
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006260 "DNA replication" evidence=IEA
GO:0006270 "DNA replication initiation" evidence=ISS
GO:0008094 "DNA-dependent ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
ZFIN|ZDB-GENE-041014-310 mcm9 "minichromosome maintenance complex component 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I0IUP4 MCM9 "DNA helicase MCM9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2W9 MCM9 "DNA helicase MCM9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9PA91 MCM9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NRM6 mcm9 "DNA helicase MCM9" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXL9 MCM9 "DNA helicase MCM9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6RIX4 mcm9 "DNA helicase MCM9" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1918817 Mcm9 "minichromosome maintenance complex component 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF38 MCM9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00190151
hypothetical protein (739 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.IX.2304.1
hypothetical protein (321 aa)
  •     0.425

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
COG1241 682 COG1241, MCM2, Predicted ATPase involved in replic 8e-83
smart00350 509 smart00350, MCM, minichromosome maintenance protei 2e-71
pfam00493 327 pfam00493, MCM, MCM2/3/5 family 1e-61
PTZ00111 915 PTZ00111, PTZ00111, DNA replication licensing fact 6e-27
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-07
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  267 bits (684), Expect = 8e-83
 Identities = 137/389 (35%), Positives = 211/389 (54%), Gaps = 31/389 (7%)

Query: 38  YPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIH 97
             L +D ++L + DPE+A L+   P + +  FE A      ++F E+         K IH
Sbjct: 31  RSLEVDLSDLEEYDPELAGLLLENPEEIIPLFEKALDEIALLLFPEV-----DRSLKKIH 85

Query: 98  VRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSG--ATKMYEGERTYMCRKCK 155
           VR      P        SI  +R +H G L++++G V R+     ++ +    + C KC 
Sbjct: 86  VRFK--NLPNRL-----SIRELRSEHIGKLVSVEGIVTRASEVRPRLKKA--VFECPKCG 136

Query: 156 HMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGV 215
               V    ++   +  P  C +           + V       D+Q++KIQE  +++  
Sbjct: 137 REVEVE---QSEFRVEPPRECEN--CGKFGKGPLKLVPRKSEFIDFQKVKIQELPELVPG 191

Query: 216 GVIPRSILVILKDDLVDIVKAGDDVIVTGILTAKWSPDLKDVRCDL--DPVLIANHVRRT 273
           G +PRSI VIL+DDLVD V+ GD V +TG++    S  L   R     +  L AN V + 
Sbjct: 192 GELPRSIEVILEDDLVDSVRPGDRVKITGVVRIVPSRSLSGRRKGPVFEIYLEANSVEKL 251

Query: 274 NELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGG 333
           ++ + +++I ++   + K+  ++  D      + +++ I P ++G   VK A+ L L GG
Sbjct: 252 DK-REEVEITEEDEEEIKEL-AKRPDI----YDILIKSIAPSIYGHEDVKKAILLQLFGG 305

Query: 334 VQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVK 393
           V+     GT++RG+ H+LLVGDPGT KSQ LK+ AKL+ R V T+G GS++AGLT   V+
Sbjct: 306 VKKNLPDGTRIRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVR 365

Query: 394 D--GGEWMLEAGALVLADGGLCCIDEFDR 420
           D   GEW+LEAGALVLADGG+CCIDEFD+
Sbjct: 366 DKVTGEWVLEAGALVLADGGVCCIDEFDK 394

Length = 682
>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 100.0
COG1241 682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0481 729 consensus DNA replication licensing factor, MCM5 c 100.0
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 100.0
KOG0477 854 consensus DNA replication licensing factor, MCM2 c 100.0
KOG0482 721 consensus DNA replication licensing factor, MCM7 c 100.0
KOG0478 804 consensus DNA replication licensing factor, MCM4 c 100.0
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 100.0
smart00350 509 MCM minichromosome maintenance proteins. 100.0
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 100.0
PF14551121 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1 99.63
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.03
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.83
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 98.81
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.81
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.72
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.7
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 98.67
COG0606 490 Predicted ATPase with chaperone activity [Posttran 98.67
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.59
PRK09862 506 putative ATP-dependent protease; Provisional 98.51
CHL00181 287 cbbX CbbX; Provisional 98.33
PRK13531 498 regulatory ATPase RavA; Provisional 98.3
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.16
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.13
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.1
COG0714 329 MoxR-like ATPases [General function prediction onl 98.08
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 98.06
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.04
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 97.98
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.8
PHA02244 383 ATPase-like protein 97.77
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.68
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.67
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.63
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.62
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.61
PF07726131 AAA_3: ATPase family associated with various cellu 97.57
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.57
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.55
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.49
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.43
PF00004132 AAA: ATPase family associated with various cellula 97.36
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.35
smart00382148 AAA ATPases associated with a variety of cellular 97.33
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.29
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.28
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.15
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 97.11
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.99
PRK11608 326 pspF phage shock protein operon transcriptional ac 96.97
PLN03025 319 replication factor C subunit; Provisional 96.94
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.93
PRK13765 637 ATP-dependent protease Lon; Provisional 96.91
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 96.87
CHL00195 489 ycf46 Ycf46; Provisional 96.75
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 96.7
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.69
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 96.63
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 96.62
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 96.56
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 96.54
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.46
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.43
PRK15424 538 propionate catabolism operon regulatory protein Pr 96.42
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.42
PRK03992 389 proteasome-activating nucleotidase; Provisional 96.38
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 96.31
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 96.3
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 96.28
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 96.25
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 96.24
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.23
PF13337 457 Lon_2: Putative ATP-dependent Lon protease 96.2
PRK12402 337 replication factor C small subunit 2; Reviewed 96.17
PRK05022 509 anaerobic nitric oxide reductase transcription reg 96.17
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 96.17
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.13
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 96.12
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 95.92
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 95.9
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 95.9
COG2204 464 AtoC Response regulator containing CheY-like recei 95.89
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.87
PRK08903 227 DnaA regulatory inactivator Hda; Validated 95.87
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 95.82
PHA02544 316 44 clamp loader, small subunit; Provisional 95.72
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 95.72
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.71
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.69
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 95.63
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 95.57
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 95.56
COG1221 403 PspF Transcriptional regulators containing an AAA- 95.56
PRK13342 413 recombination factor protein RarA; Reviewed 95.52
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 95.49
PHA01747 425 putative ATP-dependent protease 95.37
PRK04195 482 replication factor C large subunit; Provisional 95.36
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 95.34
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.34
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.31
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 95.31
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.29
PRK06620214 hypothetical protein; Validated 95.09
PRK15455 644 PrkA family serine protein kinase; Provisional 95.08
CHL00095 821 clpC Clp protease ATP binding subunit 95.07
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.06
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.92
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.85
PRK15115 444 response regulator GlrR; Provisional 94.69
PRK10365 441 transcriptional regulatory protein ZraR; Provision 94.63
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 94.52
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.51
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 94.51
PRK10865 857 protein disaggregation chaperone; Provisional 94.5
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 94.33
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.29
PRK10865 857 protein disaggregation chaperone; Provisional 94.27
PRK06893 229 DNA replication initiation factor; Validated 94.25
CHL00095 821 clpC Clp protease ATP binding subunit 94.23
PRK09087 226 hypothetical protein; Validated 94.19
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 94.17
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 94.15
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 94.14
PF05729166 NACHT: NACHT domain 94.11
PRK00440 319 rfc replication factor C small subunit; Reviewed 94.11
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.09
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.06
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 94.06
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.05
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 94.02
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 93.99
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 93.98
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 93.96
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.95
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.84
cd01878204 HflX HflX subfamily. A distinct conserved domain w 93.78
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 93.68
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 93.67
PRK14532 188 adenylate kinase; Provisional 93.62
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.61
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.59
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 93.55
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.52
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 93.47
cd04137 180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 93.47
PHA00729 226 NTP-binding motif containing protein 93.46
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 93.45
COG4619 223 ABC-type uncharacterized transport system, ATPase 93.42
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 93.37
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.33
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.32
PF1324576 AAA_19: Part of AAA domain 93.32
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 93.31
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 93.3
PF1355562 AAA_29: P-loop containing region of AAA domain 93.29
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 93.14
PRK08533 230 flagellar accessory protein FlaH; Reviewed 93.11
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 93.1
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 93.08
TIGR00073 207 hypB hydrogenase accessory protein HypB. HypB is i 93.06
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 93.04
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 93.04
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 93.02
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 93.01
PRK08181269 transposase; Validated 93.0
PRK14530 215 adenylate kinase; Provisional 92.99
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 92.98
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 92.97
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 92.95
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 92.94
cd00154159 Rab Rab family. Rab GTPases form the largest famil 92.93
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 92.86
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 92.83
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 92.83
PRK12377248 putative replication protein; Provisional 92.81
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.8
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 92.8
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.76
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 92.71
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 92.7
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 92.66
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 92.64
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 92.62
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 92.61
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 92.59
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 92.55
PRK13947171 shikimate kinase; Provisional 92.54
PRK06526254 transposase; Provisional 92.54
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 92.51
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 92.49
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 92.49
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 92.48
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 92.48
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 92.42
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 92.41
PRK00411 394 cdc6 cell division control protein 6; Reviewed 92.37
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 92.35
PRK00131175 aroK shikimate kinase; Reviewed 92.28
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 92.25
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 92.25
PRK08118167 topology modulation protein; Reviewed 92.23
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.17
PRK03839 180 putative kinase; Provisional 92.14
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 92.13
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.11
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 92.09
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 92.08
PRK07261171 topology modulation protein; Provisional 92.07
cd04127 180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 92.04
TIGR02237 209 recomb_radB DNA repair and recombination protein R 92.03
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 92.01
CHL00176 638 ftsH cell division protein; Validated 91.98
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 91.96
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 91.95
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 91.94
cd03112158 CobW_like The function of this protein family is u 91.92
PRK09112 351 DNA polymerase III subunit delta'; Validated 91.89
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 91.87
KOG1969 877 consensus DNA replication checkpoint protein CHL12 91.86
PRK06921266 hypothetical protein; Provisional 91.84
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 91.84
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 91.78
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 91.78
cd04118 193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 91.76
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 91.75
PRK07471 365 DNA polymerase III subunit delta'; Validated 91.74
PRK09183259 transposase/IS protein; Provisional 91.7
PRK14526 211 adenylate kinase; Provisional 91.7
COG0563 178 Adk Adenylate kinase and related kinases [Nucleoti 91.7
cd00876160 Ras Ras family. The Ras family of the Ras superfam 91.69
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 91.68
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 91.61
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 91.6
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 91.58
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 91.56
PHA02774 613 E1; Provisional 91.55
cd04107 201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 91.53
KOG0079 198 consensus GTP-binding protein H-ray, small G prote 91.51
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 91.51
PRK05642 234 DNA replication initiation factor; Validated 91.5
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 91.49
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 91.46
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.46
PRK00454196 engB GTP-binding protein YsxC; Reviewed 91.43
cd04132 187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 91.42
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 91.4
KOG0736 953 consensus Peroxisome assembly factor 2 containing 91.36
KOG0080 209 consensus GTPase Rab18, small G protein superfamil 91.36
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 91.34
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 91.34
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.33
cd04152 183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 91.31
PRK13949169 shikimate kinase; Provisional 91.28
PRK00300 205 gmk guanylate kinase; Provisional 91.28
TIGR03263 180 guanyl_kin guanylate kinase. Members of this famil 91.26
TIGR02322 179 phosphon_PhnN phosphonate metabolism protein/1,5-b 91.25
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 91.25
PRK06835329 DNA replication protein DnaC; Validated 91.23
PRK08084 235 DNA replication initiation factor; Provisional 91.23
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 91.22
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.21
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 91.19
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 91.17
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 91.16
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 91.14
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 91.11
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 91.07
smart00174 174 RHO Rho (Ras homology) subfamily of Ras-like small 91.07
PRK00625173 shikimate kinase; Provisional 91.05
cd01852 196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 91.03
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 91.03
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.02
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 91.02
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 90.99
TIGR01359 183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 90.98
PRK13695 174 putative NTPase; Provisional 90.98
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 90.98
PRK08727 233 hypothetical protein; Validated 90.98
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 90.97
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 90.94
PRK05057172 aroK shikimate kinase I; Reviewed 90.93
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 90.93
PTZ00088 229 adenylate kinase 1; Provisional 90.91
PRK06851367 hypothetical protein; Provisional 90.9
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 90.89
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 90.88
PRK11823 446 DNA repair protein RadA; Provisional 90.87
PF13479 213 AAA_24: AAA domain 90.81
cd04110 199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 90.8
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 90.78
PRK12288347 GTPase RsgA; Reviewed 90.77
PLN03108 210 Rab family protein; Provisional 90.76
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 90.75
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.74
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 90.72
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 90.71
PRK06762166 hypothetical protein; Provisional 90.67
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 90.65
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 90.62
PRK07940 394 DNA polymerase III subunit delta'; Validated 90.6
cd04133 176 Rop_like Rop subfamily. The Rop (Rho-related prote 90.58
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 90.58
PRK02496 184 adk adenylate kinase; Provisional 90.57
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 90.55
PRK14531 183 adenylate kinase; Provisional 90.55
cd01874 175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 90.55
cd04135 174 Tc10 TC10 subfamily. TC10 is a Rho family protein 90.51
PRK08116268 hypothetical protein; Validated 90.5
PTZ00133182 ADP-ribosylation factor; Provisional 90.5
PRK13851 344 type IV secretion system protein VirB11; Provision 90.47
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 90.47
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 90.45
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.42
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 90.42
PTZ00035 337 Rad51 protein; Provisional 90.42
PRK14528 186 adenylate kinase; Provisional 90.42
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 90.4
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 90.38
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 90.38
PLN03071 219 GTP-binding nuclear protein Ran; Provisional 90.38
cd04134 189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 90.37
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 90.36
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 90.34
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 90.34
PTZ00369 189 Ras-like protein; Provisional 90.32
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 90.31
PHA02530 300 pseT polynucleotide kinase; Provisional 90.28
cd04125 188 RabA_like RabA-like subfamily. RabA was first iden 90.28
COG1618179 Predicted nucleotide kinase [Nucleotide transport 90.25
TIGR02236 310 recomb_radA DNA repair and recombination protein R 90.2
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 90.17
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 90.15
cd01394 218 radB RadB. The archaeal protein radB shares simila 90.15
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.13
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.08
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 90.08
cd03269 210 ABC_putative_ATPase This subfamily is involved in 90.08
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 90.07
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 90.07
PRK08939306 primosomal protein DnaI; Reviewed 90.06
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 90.05
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 90.05
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 90.04
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 90.01
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 90.01
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 89.98
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 89.96
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 89.96
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 89.94
cd04123162 Rab21 Rab21 subfamily. The localization and functi 89.94
KOG0078 207 consensus GTP-binding protein SEC4, small G protei 89.93
cd04144 190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 89.92
COG1484254 DnaC DNA replication protein [DNA replication, rec 89.89
PRK07952244 DNA replication protein DnaC; Validated 89.88
cd04111 211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 89.87
cd04109 215 Rab28 Rab28 subfamily. First identified in maize, 89.83
PRK15494 339 era GTPase Era; Provisional 89.81
smart00178184 SAR Sar1p-like members of the Ras-family of small 89.81
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 89.8
cd01870 175 RhoA_like RhoA-like subfamily. The RhoA subfamily 89.79
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 89.78
PRK06217 183 hypothetical protein; Validated 89.77
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 89.76
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 89.74
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 89.73
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 89.7
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 89.7
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 89.69
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 89.67
cd04131 178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 89.67
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 89.66
cd04142 198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 89.66
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 89.64
cd04172 182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 89.64
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 89.63
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 89.6
cd03246173 ABCC_Protease_Secretion This family represents the 89.59
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 89.57
PRK13341 725 recombination factor protein RarA/unknown domain f 89.56
cd04129 187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 89.54
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 89.52
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 89.52
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 89.5
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 89.49
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 89.48
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 89.47
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 89.46
PRK09984 262 phosphonate/organophosphate ester transporter subu 89.46
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 89.44
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 89.41
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 89.41
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 89.41
cd04121 189 Rab40 Rab40 subfamily. This subfamily contains Rab 89.39
cd00881 189 GTP_translation_factor GTP translation factor fami 89.37
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 89.34
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 89.33
PRK00093 435 GTP-binding protein Der; Reviewed 89.32
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 89.31
cd04102 202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 89.29
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 89.29
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 89.28
PLN02200 234 adenylate kinase family protein 89.28
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 89.28
cd01873 195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 89.24
PRK09825 176 idnK D-gluconate kinase; Provisional 89.21
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 89.2
PRK04040 188 adenylate kinase; Provisional 89.19
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 89.16
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 89.15
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 89.12
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 89.11
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 89.07
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 89.07
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 89.06
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 89.05
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 89.02
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 89.01
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 89.0
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 88.99
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 88.99
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 88.97
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 88.97
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 88.94
cd04112 191 Rab26 Rab26 subfamily. First identified in rat pan 88.91
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 88.9
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 88.88
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 88.85
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.84
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.82
PLN03118 211 Rab family protein; Provisional 88.82
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 88.82
KOG0087 222 consensus GTPase Rab11/YPT3, small G protein super 88.81
cd03215182 ABC_Carb_Monos_II This family represents domain II 88.77
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 88.73
PRK04213 201 GTP-binding protein; Provisional 88.7
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 88.68
cd04105 203 SR_beta Signal recognition particle receptor, beta 88.66
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 88.66
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 88.65
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 88.6
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 88.57
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 88.55
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 88.54
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 88.51
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 88.49
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 88.49
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 88.48
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 88.47
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 88.46
PLN02459 261 probable adenylate kinase 88.46
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 88.46
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 88.44
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 88.43
cd01875 191 RhoG RhoG subfamily. RhoG is a GTPase with high se 88.41
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 88.41
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 88.37
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 88.37
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 88.35
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 88.34
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 88.31
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 88.3
PRK12422 445 chromosomal replication initiation protein; Provis 88.28
TIGR00235 207 udk uridine kinase. Model contains a number of lon 88.26
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 88.24
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 88.22
CHL00206 2281 ycf2 Ycf2; Provisional 88.22
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 88.21
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 88.2
cd04128 182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 88.19
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 88.15
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 88.15
PRK00279 215 adk adenylate kinase; Reviewed 88.13
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 88.13
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 88.08
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 88.08
PRK05564 313 DNA polymerase III subunit delta'; Validated 88.08
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 88.08
COG3638 258 ABC-type phosphate/phosphonate transport system, A 88.07
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 88.06
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 88.05
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 88.03
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 88.02
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 88.01
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 88.01
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 88.0
cd01889 192 SelB_euk SelB subfamily. SelB is an elongation fac 87.97
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 87.97
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 87.95
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 87.95
PRK12339 197 2-phosphoglycerate kinase; Provisional 87.94
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 87.93
PRK14738 206 gmk guanylate kinase; Provisional 87.92
cd04171164 SelB SelB subfamily. SelB is an elongation factor 87.92
PRK00089 292 era GTPase Era; Reviewed 87.89
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 87.88
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 87.87
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 87.86
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 87.85
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 87.85
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-90  Score=692.46  Aligned_cols=390  Identities=32%  Similarity=0.495  Sum_probs=322.7

Q ss_pred             CChHHHHHH-HHHHHHHHhH--------HHHHHhhcCCCCCCceeEEEechhhhc-cCHHHHHHHHhChHHHHHHHHHHH
Q 014661            4 ENVPAHLKA-LAEFVIRHHS--------DQLRSITLSPDPKLHYPLYIDFAELLD-EDPEIAHLVFSKPADYLRFFEDAA   73 (420)
Q Consensus         4 ~~~~~~i~~-f~~Fl~~~y~--------~~i~~~~~~~~~~~~~sl~Id~~dL~~-~~p~La~~l~~~P~~~l~~~e~ai   73 (420)
                      +.+++.+++ |.+||+.|+.        ..+..+..   + ...+|.||+.||.+ +++.|+..|.++|..++|++..|+
T Consensus        19 d~~g~~~~e~~~~Fle~~~~~~~e~~~~~~i~~~~~---~-~~~tl~vd~~~l~~~~~~~la~~l~~~~~r~~p~m~~av   94 (764)
T KOG0480|consen   19 DTTGERVEEEFLQFLESFKVQAGEKKYLQSIELLDR---P-ERNTLLVDFQHLSKQYNQNLATALEENYYRVLPCMCRAV   94 (764)
T ss_pred             cccccchHHHHHHHHHHhhccccchhhHHHHHhhcc---C-CCceEEEEHHHHHhhhhHHHHHHHHHhhhhhHHHHHHHH
Confidence            344566654 8889888754        33333321   2 45799999999999 999999999999999999999999


Q ss_pred             HHHHHHHhhccchhhhhccceeEEEEEeecCCCCCCCCCCcccccccccccccEEEEEEEEEEecceeEEEEEEEEEecC
Q 014661           74 IWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRK  153 (420)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~i~vri~~~~~p~~~p~~~~~~~~l~~~~igkLV~v~G~V~r~s~vk~~~~~~~f~C~~  153 (420)
                      ..+....     +.+.....+.+++||+      |+|. ...+|+|++..+|+||.+.|+|+|+|+|+|.+++++|.|..
T Consensus        95 ~~~l~d~-----~~~~~~~~~~~~v~f~------nlp~-~~~irdlra~~iG~Lv~isGtVvRts~VrPelt~~~F~C~~  162 (764)
T KOG0480|consen   95 HKVLKDW-----STNSGALVKKIYVRFY------NLPT-RHKIRDLRAARIGKLVRISGTVVRTSPVRPELTKMTFLCEK  162 (764)
T ss_pred             HHHHHcc-----cccccccceeEEEEEe------cccc-ccccccccHhhhcceEEEEEEEEEeecccceeeeeEEEHhh
Confidence            8876531     0112234567899998      6774 47899999999999999999999999999999999999999


Q ss_pred             CCceeeeccccccccceecCCCCCCCCCCCCCC-CceEEecceeeEeeeeEEEEeecccccCCCCcceEEEEEEecCccC
Q 014661          154 CKHMFPVYPELETRNSIVLPSHCPSQRSKPCEG-TNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVD  232 (420)
Q Consensus       154 C~~~~~~~~~~~~~~~~~~P~~C~~~~~~~C~~-~~f~~~~~~s~~~d~Q~IkiQE~~e~~~~g~~pr~i~v~L~~dLv~  232 (420)
                      ||..+..   .++.++|+.|+.||+   ..|.+ +.|.++.+++.|.|||+|||||..++.|.|.+||+++|+|++|+|+
T Consensus       163 C~t~i~~---v~q~fkYt~Pt~C~n---p~C~nrr~f~l~~~~s~f~D~QkIrIQE~~~E~p~GsiPRtvdviLr~dlVe  236 (764)
T KOG0480|consen  163 CGTVIRN---VEQQFKYTEPTKCPN---PVCSNRRSFTLDRSSSRFLDWQKIRIQELQAEIPRGSIPRTVDVILRGDLVE  236 (764)
T ss_pred             CCCeecc---chhcCccCCCccCCC---ccccCCceeeeecccceeeeeeeeehhhhhhhCCCCCCCceeEEEEhhhhHh
Confidence            9998653   357889999999997   57877 4699999999999999999999999999999999999999999999


Q ss_pred             ceecCCeEEEEEEEEeeec------CCCc--Cccc----ccceEEEEeeEEEccCc--c------CCC------------
Q 014661          233 IVKAGDDVIVTGILTAKWS------PDLK--DVRC----DLDPVLIANHVRRTNEL--K------SDI------------  280 (420)
Q Consensus       233 ~~~pGd~V~v~GIl~~~~~------~~~~--~~~~----~~~~~i~a~~I~~~~~~--~------~~~------------  280 (420)
                      +++|||+|.+|||+...+.      ++.+  +.++    .+=++++|++|+..+-.  |      ...            
T Consensus       237 ~~~pGD~v~~TGiliVvpdv~~l~~pgsk~~n~r~~~~~~~i~~lkal~Vrdl~yq~aFlac~~~~~~~~ee~~~~~~~~  316 (764)
T KOG0480|consen  237 TAQPGDKVDITGILIVVPDVSQLGGPGSKAENNRGGETGDGITGLKALGVRDLTYQLAFLACHVQSTLAVEEDDEEDMLN  316 (764)
T ss_pred             hcCCCCEEEEEEEEEEecChHHhcCCccccccccCCCcccceeeehhcccccchhhhhHhhhhcccccccchhhhHHHhh
Confidence            9999999999999998774      1111  1111    22346778888754321  0      001            


Q ss_pred             CCCHHHHHHHHHHHHhhcCCCccchhhhhhccCCcccCCHHHHHHHHHHHhcCceeeCCCCCcccCcccEEEEcCCCchh
Q 014661          281 DIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGK  360 (420)
Q Consensus       281 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~siaP~i~G~~~~K~ailL~L~gg~~~~~~~g~~~Rg~ihiLlvGdpg~gK  360 (420)
                      .++.+|...+.+.    ..++ +.|..|++|+||+||||+.||+||||+||||+.|...+|+++|||||||+||||||||
T Consensus       317 ~~s~~e~~~~~em----~~~~-nly~~lv~Sl~PsIyGhe~VK~GilL~LfGGv~K~a~eg~~lRGDinv~iVGDPgt~K  391 (764)
T KOG0480|consen  317 SMSSEEFAEIREM----SKDE-NLYKNLVNSLFPSIYGHELVKAGILLSLFGGVHKSAGEGTSLRGDINVCIVGDPGTGK  391 (764)
T ss_pred             hccHHHHHHHHHH----hcCc-hHHHHHHHhhCccccchHHHHhhHHHHHhCCccccCCCCccccCCceEEEeCCCCccH
Confidence            1223333333222    2233 3788999999999999999999999999999999988999999999999999999999


Q ss_pred             hHHHHHHhccCCcEEEEeccccccCCceeeEEeeC--CceeeccceeeecCCceEeeecccC
Q 014661          361 SQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDG--GEWMLEAGALVLADGGLCCIDEFDR  420 (420)
Q Consensus       361 SqlL~~~~~~~p~~v~~~G~~ss~~gLt~~~~r~~--g~~~leaGalvlad~Gv~ciDe~dK  420 (420)
                      ||+|++++.++||||||||+.||+||||||++||+  |+|++|||||||||+||||||||||
T Consensus       392 SQfLk~v~~fsPR~vYtsGkaSSaAGLTaaVvkD~esgdf~iEAGALmLADnGICCIDEFDK  453 (764)
T KOG0480|consen  392 SQFLKAVCAFSPRSVYTSGKASSAAGLTAAVVKDEESGDFTIEAGALMLADNGICCIDEFDK  453 (764)
T ss_pred             HHHHHHHhccCCcceEecCcccccccceEEEEecCCCCceeeecCcEEEccCceEEechhcc
Confidence            99999999999999999999999999999999998  9999999999999999999999998

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF14551 MCM_N: MCM N-terminal domain; PDB: 2VL6_C 3F9V_A 1LTL_E Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
3f9v_A 595 Crystal Structure Of A Near Full-Length Archaeal Mc 6e-37
1ltl_A279 The Dodecamer Structure Of Mcm From Archaeal M. The 3e-12
2vl6_A268 Structural Analysis Of The Sulfolobus Solfataricus 6e-11
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure 
Iteration: 1

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/387 (30%), Positives = 202/387 (52%), Gaps = 29/387 (7%)
Query: 40  LYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFIHVR 99
           L I+F+++L  +  +A+ + +     L   E  A++ H +  D   + ++ +EK  +HVR
Sbjct: 39  LIIEFSDVLSFNENLAYEIINNTKIILPILE-GALYDHILQLD--PTYQRDIEK--VHVR 93
Query: 100 INVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATK--MYEGERTYMCRKCKHM 157
           I      +  P     + ++R    G L+T+ G +++    K  +Y+    ++   C   
Sbjct: 94  I------VGIPRVI-ELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQE 146
Query: 158 FPVYPELETRNSIV-LPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVG 216
           F  +PE E    ++ +P+ CP +  KP +   F+ +       D+Q+  IQE  + +  G
Sbjct: 147 FE-WPEDEEMPEVLEMPTICP-KCGKPGQ---FRLIPEKTKLIDWQKAVIQERPEEVPSG 201
Query: 217 VIPRSILVILKDDLVDIVKAGDDVIVTGILTAKW-SPDLKDVRCDLDPVLIANHVRRTNE 275
            +PR + +IL+DDLVD  + GD V VTGIL  K  SP  +  R   D  +  + +  + +
Sbjct: 202 QLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVSQK 261
Query: 276 LKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGGVQ 335
           +  ++ I ++   + K      KD  ++ R  I+  I P ++G + +K A+AL L GGV 
Sbjct: 262 VLDEVIISEEDEKKIKDLA---KDPWIRDR--IISSIAPSIYGHWELKEALALALFGGVP 316
Query: 336 HVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVIXXXXXXXXXXXXXXAVKD- 394
            V    T++RG+ H+L++GDPGT KSQ L+F ++++ R+V                V++ 
Sbjct: 317 KV-LEDTRIRGDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREK 375
Query: 395 -GGEWMLEAGALVLADGGLCCIDEFDR 420
             GE+ LEAGALVLADGG+  IDE D+
Sbjct: 376 GTGEYYLEAGALVLADGGIAVIDEIDK 402
>pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 Back     alignment and structure
>pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 1e-117
3f8t_A 506 Predicted ATPase involved in replication control, 4e-72
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 3e-48
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 8e-45
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
 Score =  353 bits (909), Expect = e-117
 Identities = 120/388 (30%), Positives = 197/388 (50%), Gaps = 27/388 (6%)

Query: 37  HYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELKSCEKRVEKKFI 96
              L I+F+++L  +  +A+ + +     L   E A    +  +     + ++ +EK  +
Sbjct: 36  KKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGAL---YDHILQLDPTYQRDIEK--V 90

Query: 97  HVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCK- 155
           HVRI   G P         + ++R    G L+T+ G +++    K    + TY       
Sbjct: 91  HVRI--VGIPRVI-----ELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDC 143

Query: 156 -HMFPVYPELETRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLG 214
              F    + E    + +P+ CP           F+ +       D+Q+  IQE  + + 
Sbjct: 144 MQEFEWPEDEEMPEVLEMPTICPKCGKP----GQFRLIPEKTKLIDWQKAVIQERPEEVP 199

Query: 215 VGVIPRSILVILKDDLVDIVKAGDDVIVTGILTAK-WSPDLKDVRCDLDPVLIANHVRRT 273
            G +PR + +IL+DDLVD  + GD V VTGIL  K  SP  +  R   D  +  + +  +
Sbjct: 200 SGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVS 259

Query: 274 NELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQVFGLFTVKLAVALTLIGG 333
            ++  ++ I ++   + K    +        R+ I+  I P ++G + +K A+AL L GG
Sbjct: 260 QKVLDEVIISEEDEKKIKDLAKD-PWI----RDRIISSIAPSIYGHWELKEALALALFGG 314

Query: 334 VQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVK 393
           V  V    T++RG+ H+L++GDPGT KSQ L+F ++++ R+V TTG GST+AGLT   V+
Sbjct: 315 VPKV-LEDTRIRGDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVR 373

Query: 394 DG--GEWMLEAGALVLADGGLCCIDEFD 419
           +   GE+ LEAGALVLADGG+  IDE D
Sbjct: 374 EKGTGEYYLEAGALVLADGGIAVIDEID 401
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 100.0
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 100.0
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 100.0
3f8t_A 506 Predicted ATPase involved in replication control, 100.0
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.88
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.83
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.78
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.47
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.34
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.28
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.11
3co5_A143 Putative two-component system transcriptional RES 98.03
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.02
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.93
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.92
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.91
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.88
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.75
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.59
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 97.58
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.57
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 97.51
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.51
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.46
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.45
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 97.45
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.41
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 97.35
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.34
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.27
3pvs_A 447 Replication-associated recombination protein A; ma 97.24
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.24
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.09
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.07
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.04
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.03
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 97.03
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 97.0
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.88
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.78
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.78
3bos_A 242 Putative DNA replication factor; P-loop containing 96.71
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.62
2chq_A 319 Replication factor C small subunit; DNA-binding pr 96.62
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.6
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 96.39
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.33
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 96.33
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.27
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.23
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.17
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 96.17
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.14
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.12
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.11
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.98
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.98
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.92
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.82
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 95.8
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.72
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 95.6
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.51
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 95.39
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.37
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 95.16
3io5_A 333 Recombination and repair protein; storage dimer, i 95.11
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 95.11
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 94.95
1tue_A212 Replication protein E1; helicase, replication, E1E 94.88
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.84
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.7
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 94.67
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 94.52
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 94.44
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 94.43
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 94.36
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.35
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 94.26
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 94.24
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.2
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 94.17
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.96
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 93.91
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 93.88
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 93.84
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 93.8
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.78
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 93.77
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 93.62
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.61
4a74_A 231 DNA repair and recombination protein RADA; hydrola 93.6
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.57
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 93.57
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 93.5
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 93.5
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.48
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 93.44
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.43
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 93.41
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.4
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.36
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.36
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.33
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 93.33
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 93.29
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.29
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.27
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.27
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.26
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.26
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.23
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.14
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.13
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.07
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.02
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.01
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.97
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 92.95
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 92.93
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.91
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.83
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.81
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.78
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 92.77
3llu_A 196 RAS-related GTP-binding protein C; structural geno 92.77
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 92.77
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.74
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 92.73
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 92.72
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 92.71
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 92.69
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 92.68
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.64
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 92.64
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 92.63
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.63
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 92.63
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 92.63
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 92.61
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.59
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.59
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.54
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.53
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 92.52
2r2a_A 199 Uncharacterized protein; zonular occludens toxin, 92.48
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 92.45
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 92.45
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 92.43
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.43
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 92.43
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.42
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 92.41
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 92.4
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.38
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 92.36
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 92.3
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 92.28
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.28
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.27
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.27
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 92.25
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 92.25
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 92.23
1nrj_B 218 SR-beta, signal recognition particle receptor beta 92.21
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.2
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 92.2
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 92.19
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 92.19
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 92.16
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.14
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 92.12
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 92.11
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 92.11
2qgz_A308 Helicase loader, putative primosome component; str 92.1
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 92.06
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 92.04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.03
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.03
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 92.01
2ged_A193 SR-beta, signal recognition particle receptor beta 91.98
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 91.95
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 91.94
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.9
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 91.9
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 91.83
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 91.83
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 91.81
2fh5_B 214 SR-beta, signal recognition particle receptor beta 91.78
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 91.78
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.78
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 91.71
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 91.71
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 91.7
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 91.65
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 91.64
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 91.57
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.57
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 91.48
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.42
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 91.39
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 91.38
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.38
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 91.33
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 91.3
1via_A175 Shikimate kinase; structural genomics, transferase 91.28
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 91.25
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 91.24
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 91.22
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 91.17
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 91.05
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 91.04
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 91.02
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.01
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 90.99
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 90.99
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 90.98
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.9
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 90.85
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 90.79
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 90.77
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 90.71
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 90.7
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 90.69
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 90.61
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 90.58
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 90.53
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 90.52
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.51
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.46
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 90.39
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 90.38
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 90.36
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 90.27
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 90.26
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 90.21
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.19
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 90.19
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 90.17
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 90.1
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 90.09
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 90.06
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.04
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 89.98
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 89.84
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 89.82
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.77
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 89.77
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.75
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 89.7
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 89.59
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 89.53
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 89.35
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 89.34
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 89.3
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 89.28
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.17
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 89.08
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 89.07
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.06
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 89.05
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.01
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 89.0
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 88.88
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 88.5
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 88.82
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.8
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 88.77
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 88.73
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 88.72
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 88.65
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 88.63
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.54
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 88.53
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 88.49
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 88.48
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 88.46
1sgw_A 214 Putative ABC transporter; structural genomics, P p 88.45
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 88.43
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 88.4
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 88.37
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 88.31
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 88.3
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 88.28
1g6h_A 257 High-affinity branched-chain amino acid transport 88.26
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.26
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 88.25
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 88.25
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.24
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 88.21
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 88.19
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 88.12
1b0u_A 262 Histidine permease; ABC transporter, transport pro 88.08
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 88.07
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 88.02
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 88.01
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 87.94
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 87.94
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 87.94
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 87.92
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 87.91
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 87.89
2cvh_A 220 DNA repair and recombination protein RADB; filamen 87.89
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 87.88
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 87.76
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 87.74
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.7
2vli_A 183 Antibiotic resistance protein; transferase, tunica 87.69
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 87.6
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 87.58
1ji0_A 240 ABC transporter; ATP binding protein, structural g 87.52
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 87.45
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 87.45
2z43_A 324 DNA repair and recombination protein RADA; archaea 87.42
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 87.38
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 87.35
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 87.33
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 87.31
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 87.29
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 87.19
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 87.17
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 87.16
2hf9_A 226 Probable hydrogenase nickel incorporation protein 87.12
2ghi_A 260 Transport protein; multidrug resistance protein, M 87.02
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 86.93
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 86.91
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 86.89
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 86.87
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 86.86
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 86.86
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.82
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 86.82
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 86.81
2fna_A 357 Conserved hypothetical protein; structural genomic 86.81
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 86.79
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.79
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 86.73
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 86.73
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 86.71
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.6
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 86.58
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 86.55
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.5
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.47
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 86.41
3o47_A329 ADP-ribosylation factor GTPase-activating protein 86.36
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 86.25
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 86.14
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 86.14
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.13
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 86.12
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 86.08
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 86.07
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 85.97
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 85.93
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 85.92
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 85.88
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 85.83
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 85.82
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 85.82
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 85.62
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 85.56
3kta_A182 Chromosome segregation protein SMC; structural mai 85.5
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 85.46
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 85.35
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 85.33
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 85.18
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 85.11
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 85.02
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 84.97
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 84.94
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 84.87
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 84.85
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 84.61
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 84.6
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 84.54
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 84.53
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 84.52
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.51
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 84.45
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 84.43
2eyu_A 261 Twitching motility protein PILT; pilus retraction 84.43
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 84.4
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 84.39
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 84.36
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 84.26
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 84.22
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 84.22
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 84.21
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.19
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 84.16
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 84.16
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 84.15
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 84.12
3cnl_A262 YLQF, putative uncharacterized protein; circular p 84.09
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.94
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 83.84
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.83
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 83.79
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 83.78
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 83.78
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 83.78
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 83.68
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 83.66
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 83.66
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 83.44
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 83.43
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 83.29
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 83.26
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 83.25
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 83.23
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 82.92
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 82.77
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 82.76
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 82.76
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 82.58
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 82.54
1wxq_A 397 GTP-binding protein; structural genomics, riken st 82.43
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 82.33
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 82.1
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 82.01
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 81.92
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 81.91
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 81.91
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 81.88
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 81.84
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 81.69
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 81.54
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 81.54
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 81.4
2ewv_A 372 Twitching motility protein PILT; pilus retraction 81.3
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 81.25
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 81.17
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 81.1
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 81.02
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 80.82
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 80.53
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 80.47
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 80.45
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 80.35
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 80.22
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 80.07
1p9r_A 418 General secretion pathway protein E; bacterial typ 80.03
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
Probab=100.00  E-value=1.3e-72  Score=594.07  Aligned_cols=386  Identities=31%  Similarity=0.515  Sum_probs=340.2

Q ss_pred             HHHHHHHHHHHHH--------hHHHHHHhhcCCCCCCceeEEEechhhhccCHHHHHHHHhChHHHHHHHHHHHHHHHHH
Q 014661            8 AHLKALAEFVIRH--------HSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKI   79 (420)
Q Consensus         8 ~~i~~f~~Fl~~~--------y~~~i~~~~~~~~~~~~~sl~Id~~dL~~~~p~La~~l~~~P~~~l~~~e~ai~~~~~~   79 (420)
                      |..++|++||++|        |.++|++|+..    .+++|.||++||.+|+|+||++|+++|.+++++|++|+++++..
T Consensus         3 ~~~~~f~~Fl~~~~~~~~~~~y~~~i~~~~~~----~~~~l~v~~~~l~~~~~~l~~~l~~~p~~~~~~~~~a~~~~~~~   78 (595)
T 3f9v_A            3 DYRDVFIEFLTTFKGNNNQNKYIERINELVAY----RKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQ   78 (595)
T ss_dssp             CHHHHHHHHHHHCCTTTTSCTTHHHHHHHHHH----TCSSCCEEHHHHHTTCTTHHHHHHTTHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhhccCCChhHHHHHHHHHHc----CCcEEEEEhHHHhhhCHHHHHHHHHCHHHHHHHHHHHHHHHHHh
Confidence            5678899999998        99999999865    47899999999999999999999999999999999999998663


Q ss_pred             HhhccchhhhhccceeEEEEEeecCCCCCCCCCCcccccccccccccEEEEEEEEEEecceeEEEEEEEEEecC--CCce
Q 014661           80 VFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRK--CKHM  157 (420)
Q Consensus        80 ~~~~~~~~~~~~~~~~i~vri~~~~~p~~~p~~~~~~~~l~~~~igkLV~v~G~V~r~s~vk~~~~~~~f~C~~--C~~~  157 (420)
                      ..   +..  ....+.+|||+.      ++| ...++|+|++.++||||+|+|+|+|+|.|+|++.+++|.|.+  ||+.
T Consensus        79 ~~---~~~--~~~~~~~~v~~~------~~~-~~~~~r~l~~~~i~~lv~v~G~V~r~s~v~~~~~~~~~~C~~~~C~~~  146 (595)
T 3f9v_A           79 LD---PTY--QRDIEKVHVRIV------GIP-RVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQE  146 (595)
T ss_dssp             HC---GGG--TTTCCCCCCCEE------CCS-CEECGGGCCGGGTTCCEEEEEEEEEECCCEEEEEECCCEEESSSCCCB
T ss_pred             hc---hhh--hhccceEEEEEe------CCC-CCCChhhcchhhCCcEEEEEEEEEEecCEEEEEEEEEEEecCCCCCCE
Confidence            22   111  112345888887      455 356799999999999999999999999999999999999999  9998


Q ss_pred             eeeccccccccceecCCCCCCCCCCCCCCC-ceEEecceeeEeeeeEEEEeecccccCCCCcceEEEEEEecCccCceec
Q 014661          158 FPVYPELETRNSIVLPSHCPSQRSKPCEGT-NFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKA  236 (420)
Q Consensus       158 ~~~~~~~~~~~~~~~P~~C~~~~~~~C~~~-~f~~~~~~s~~~d~Q~IkiQE~~e~~~~g~~pr~i~v~L~~dLv~~~~p  236 (420)
                      +.+.......+.+..|..||+     |+++ +|.++.+.|.|+|||+|+|||.|+.+|.|++||+++|+|++||||.|+|
T Consensus       147 ~~~~~~~~~~~~~~~p~~C~~-----C~~~~~~~~~~~~s~~~d~Q~i~iQe~~~~~~~g~~pr~~~v~l~~dlv~~~~p  221 (595)
T 3f9v_A          147 FEWPEDEEMPEVLEMPTICPK-----CGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARP  221 (595)
T ss_dssp             CCSSCSSCCCSSCCCCSSCTT-----TCCCSEEECCSTTCEEEEEEEEEEECCTTTSCTTSCCCEEEEEEEGGGTTCSCS
T ss_pred             EEEEeccccCCcccCCCcCCC-----CCCCCceEEeccCceeeeeEEEEEEeccccCCCCCCCceEEEEEeccccccccc
Confidence            764421124467889999984     8876 7999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEEEEEeeecCCC-cCcccccceEEEEeeEEEccCccCCCCCCHHHHHHHHHHHHhhcCCCccchhhhhhccCCc
Q 014661          237 GDDVIVTGILTAKWSPDL-KDVRCDLDPVLIANHVRRTNELKSDIDIPDDIIMQFKQFWSEFKDTPLKGRNAILRGICPQ  315 (420)
Q Consensus       237 Gd~V~v~GIl~~~~~~~~-~~~~~~~~~~i~a~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~siaP~  315 (420)
                      ||+|.|+||++..|.... ++.++.|++|++|++|+..++......+++++++.+.++++    ++ ..++.|.++++|+
T Consensus       222 Gd~v~v~Gi~~~~~~~~~~~~~~~~~~~~i~a~~i~~~~~~~~~~~~t~~~~~~i~~~~~----~~-~~~~~l~~~l~~~  296 (595)
T 3f9v_A          222 GDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVSQKVLDEVIISEEDEKKIKDLAK----DP-WIRDRIISSIAPS  296 (595)
T ss_dssp             SCEEEEEEECCCCCSSTTSCTTCCCCCCCCEEEEEEECCCCCCCCCCTTSTHHHHHTTSS----TT-TGGGTHHHHTSST
T ss_pred             CCEEEEEEEEEecccccccCCCcceEEEEEEEEeecccccccccCCCCHHHHHHHHHHhh----Cc-HHHHHHHHhhcch
Confidence            999999999999887543 23467899999999999887766677889888888876653    33 2678999999999


Q ss_pred             ccCCHHHHHHHHHHHhcCceeeCCCCCcccCcccEEEEcCCCchhhHHHHHHhccCCcEEEEeccccccCCceeeEEeeC
Q 014661          316 VFGLFTVKLAVALTLIGGVQHVDASGTKVRGESHLLLVGDPGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDG  395 (420)
Q Consensus       316 i~G~~~~K~ailL~L~gg~~~~~~~g~~~Rg~ihiLlvGdpg~gKSqlL~~~~~~~p~~v~~~G~~ss~~gLt~~~~r~~  395 (420)
                      |+|++.+|+|++++|+||..+..++ .++|+++|+||+|+||||||+|++++++.+||++|++|.+++.+||++++.++.
T Consensus       297 I~G~e~vk~al~~~l~~g~~~~~~~-~~~r~~~~vLL~GppGtGKT~LAr~la~~~~r~~~~~~~~~~~~~l~~~~~~~~  375 (595)
T 3f9v_A          297 IYGHWELKEALALALFGGVPKVLED-TRIRGDIHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREK  375 (595)
T ss_dssp             TSCCHHHHHHHTTTTTCCCCEETTT-TEECCSCCEEEEESSCCTHHHHHHSSSTTCSCEECCCTTCSTTTTSEEECSSGG
T ss_pred             hcChHHHHHHHHHHHhCCCcccccC-CCcCCCcceEEECCCchHHHHHHHHHHHhCCCceecCCCccccccccceeeecc
Confidence            9999999999999999999888777 899999999999999999999999999999999999999999999999998875


Q ss_pred             --CceeeccceeeecCCceEeeecccC
Q 014661          396 --GEWMLEAGALVLADGGLCCIDEFDR  420 (420)
Q Consensus       396 --g~~~leaGalvlad~Gv~ciDe~dK  420 (420)
                        |+|.+++|++++||+|||||||||+
T Consensus       376 ~~g~~~~~~G~l~~A~~gil~IDEid~  402 (595)
T 3f9v_A          376 GTGEYYLEAGALVLADGGIAVIDEIDK  402 (595)
T ss_dssp             GTSSCSEEECHHHHHSSSEECCTTTTC
T ss_pred             ccccccccCCeeEecCCCcEEeehhhh
Confidence              8999999999999999999999996
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 6e-39
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score =  138 bits (348), Expect = 6e-39
 Identities = 61/263 (23%), Positives = 107/263 (40%), Gaps = 33/263 (12%)

Query: 9   HLKALAEFVIR-HHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLR 67
            L    EF     + D++              + +D+ +L   DP++A L+  KP D +R
Sbjct: 6   TLTKFEEFFSLQDYKDRVFEAIEKYPNVRS--IEVDYLDLEMFDPDLADLLIEKPDDVIR 63

Query: 68  FFEDAAIWAHKIVFDELKSCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVL 127
             + A           +++ ++  +   +++R   SG     P     +  +R K  G  
Sbjct: 64  AAQQA-----------IRNIDRLRKNVDLNIRF--SGISNVIP-----LRELRSKFIGKF 105

Query: 128 LTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELETRNSIVLPSHCPSQRSKPCEGT 187
           + + G V ++   +    +  + CR C     V    ++ N I  PS C       C G 
Sbjct: 106 VAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVT---QSTNMITEPSLCS-----ECGGR 157

Query: 188 NFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGILT 247
           +F+ +++     D Q +K+QE  + L  G  PR I V+L+DDLVD +  GD V VTG L 
Sbjct: 158 SFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLR 217

Query: 248 AKWSPDLKDVRCDLDPVLIANHV 270
                   +        +  N+ 
Sbjct: 218 TVRD----ERTKRFKNFIYGNYT 236

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 100.0
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.51
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 98.1
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.82
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.48
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.42
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 97.23
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.02
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.89
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.87
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.83
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 96.74
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.66
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.5
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.49
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.39
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.34
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.26
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.03
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 96.03
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.94
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 95.79
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 95.7
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 95.64
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.62
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.56
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 95.53
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.51
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.49
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.41
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 95.15
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 95.15
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.07
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.03
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.0
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 94.97
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.94
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 94.83
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.81
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.66
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.62
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.61
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.56
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.46
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.44
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.44
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.39
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.28
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.23
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 94.14
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.11
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.1
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.08
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 94.05
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.05
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 94.05
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.04
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.95
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.94
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.88
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.84
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.7
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.67
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.58
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.57
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.54
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.43
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.42
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.33
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.23
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.21
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.2
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.19
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.14
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.09
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 93.0
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.95
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.91
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.91
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.91
d2fh5b1 207 Signal recognition particle receptor beta-subunit 92.74
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.67
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.62
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 92.58
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.57
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.55
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.47
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.47
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.41
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 92.41
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.41
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.39
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.38
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.35
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.3
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.2
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.02
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 92.01
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.99
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.98
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.96
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.95
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.94
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.91
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.84
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.82
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.76
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.65
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.59
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.57
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 91.46
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 91.4
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 91.33
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.3
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.25
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.93
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.91
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 90.86
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.78
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.78
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 90.66
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.55
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 90.52
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.44
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.29
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.22
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 90.02
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 89.99
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 89.93
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 89.88
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.62
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 89.34
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.2
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 88.84
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 88.72
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 88.38
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.34
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.31
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.9
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 87.73
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 86.97
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 86.84
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.53
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 86.43
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 86.03
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.83
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 85.78
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 85.75
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 85.54
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 85.44
d2awna2 232 Maltose transport protein MalK, N-terminal domain 85.26
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 85.17
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.06
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 84.89
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 84.81
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 84.62
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 84.33
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.03
d1g2912 240 Maltose transport protein MalK, N-terminal domain 83.93
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 83.75
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 83.71
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 83.27
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 83.15
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 82.93
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 82.11
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 82.09
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 82.08
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 82.05
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 81.8
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 81.75
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 81.57
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 81.53
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 81.22
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 80.78
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 80.42
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 80.33
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=100.00  E-value=4.1e-46  Score=347.06  Aligned_cols=234  Identities=25%  Similarity=0.390  Sum_probs=200.0

Q ss_pred             HHHHHHHHHHH-HHHhHHHHHHhhcCCCCCCceeEEEechhhhccCHHHHHHHHhChHHHHHHHHHHHHHHHHHHhhccc
Q 014661            7 PAHLKALAEFV-IRHHSDQLRSITLSPDPKLHYPLYIDFAELLDEDPEIAHLVFSKPADYLRFFEDAAIWAHKIVFDELK   85 (420)
Q Consensus         7 ~~~i~~f~~Fl-~~~y~~~i~~~~~~~~~~~~~sl~Id~~dL~~~~p~La~~l~~~P~~~l~~~e~ai~~~~~~~~~~~~   85 (420)
                      .+.+..|.+|+ .++|.++|.+++.. .+ ...+|.|||.||.+|+|+|+++|+++|.+++++|++|++++..       
T Consensus         4 ~~~l~~f~e~~~~~~y~~~i~~~~~~-~~-~~~sl~Vd~~~L~~~~~~L~~~l~~~P~~~l~~~~~ai~~~~~-------   74 (239)
T d1ltla_           4 SKTLTKFEEFFSLQDYKDRVFEAIEK-YP-NVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNIDR-------   74 (239)
T ss_dssp             HHHHHHHHHHTTSHHHHHHHHHHHHH-TT-SCCEEEEEHHHHHHHCTTHHHHHHHSHHHHHHHHHHHHTTTCT-------
T ss_pred             HHHHHHHHHHhchHhHHHHHHHHHHc-CC-CCcEEEEEHHHHHhhCHHHHHHHHHCHHHHHHHHHHHHHhHHh-------
Confidence            45667788888 46699999988764 22 2568999999999999999999999999999999999765311       


Q ss_pred             hhhhhccceeEEEEEeecCCCCCCCCCCcccccccccccccEEEEEEEEEEecceeEEEEEEEEEecCCCceeeeccccc
Q 014661           86 SCEKRVEKKFIHVRINVSGSPLECPETFPSIGRVRVKHHGVLLTLKGTVIRSGATKMYEGERTYMCRKCKHMFPVYPELE  165 (420)
Q Consensus        86 ~~~~~~~~~~i~vri~~~~~p~~~p~~~~~~~~l~~~~igkLV~v~G~V~r~s~vk~~~~~~~f~C~~C~~~~~~~~~~~  165 (420)
                          ......+++|+.      ++|. ..++|+|++.++||||+++|+|+|+|.++|++.+++|+|..|++.+.+..   
T Consensus        75 ----~~~~~~i~vr~~------~~~~-~~~ir~l~s~~igkLv~v~GiV~r~s~v~~~~~~~~~~C~~C~~~~~~~~---  140 (239)
T d1ltla_          75 ----LRKNVDLNIRFS------GISN-VIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQ---  140 (239)
T ss_dssp             ----TCCCCCCEEEEE------CCSC-BCCGGGCCGGGTTSEEEEEEEEEEECCCEEEEEEEEEEETTTCCEEEEEC---
T ss_pred             ----hccCceEEEEEc------CCCC-ccchhccchhhhccEEEEEEEEEEeCCEEEEEEEEEEECCCCCceEEEEe---
Confidence                112335788887      4553 56789999999999999999999999999999999999999999987643   


Q ss_pred             cccceecCCCCCCCCCCCCCCCceEEecceeeEeeeeEEEEeecccccCCCCcceEEEEEEecCccCceecCCeEEEEEE
Q 014661          166 TRNSIVLPSHCPSQRSKPCEGTNFQFVENSIICHDYQEIKIQESTQVLGVGVIPRSILVILKDDLVDIVKAGDDVIVTGI  245 (420)
Q Consensus       166 ~~~~~~~P~~C~~~~~~~C~~~~f~~~~~~s~~~d~Q~IkiQE~~e~~~~g~~pr~i~v~L~~dLv~~~~pGd~V~v~GI  245 (420)
                      ..+.+..|..|+     .|++++|.++.+.|.|+|||+|+|||+|++++.|++||+++|+|++||||+++|||+|.|+||
T Consensus       141 ~~~~~~~p~~C~-----~C~~~~f~~~~~~s~~~d~Q~i~iQE~~e~~~~G~~Pr~i~v~l~~dlvd~~~pGd~V~i~GI  215 (239)
T d1ltla_         141 STNMITEPSLCS-----ECGGRSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGT  215 (239)
T ss_dssp             SSSSCCCCSCCT-----TTCCCCEEECGGGCEEEEEEEEEEECCSTTCCSSCCCCEEEEEEEGGGTTCCCTTCEEEEEEE
T ss_pred             cCCeecCCccCC-----CCCCcccEEccCcceEeeeEEEEEecccccCCCCCCCcEEEEEEeccccCccCCCCEEEEEEE
Confidence            456788899997     499889999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeecCCCcCcccccceEEEEeeEEE
Q 014661          246 LTAKWSPDLKDVRCDLDPVLIANHVRR  272 (420)
Q Consensus       246 l~~~~~~~~~~~~~~~~~~i~a~~I~~  272 (420)
                      ++..+...    .+.++.+|+||||+.
T Consensus       216 ~~~~~~~~----~~~~~~~i~a~~Ie~  238 (239)
T d1ltla_         216 LRTVRDER----TKRFKNFIYGNYTEF  238 (239)
T ss_dssp             EEEEEETT----TTEEEEEEEEEECCB
T ss_pred             EEEeecCC----CCceEEEEEEEEEEE
Confidence            99876432    235789999999974
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure