Citrus Sinensis ID: 014691


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL
cccccEEEEEccEEEcccccccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHccccccEEEEccccccHHHHHHcccccccccccccccccccccccccHHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHcccccccEEEEccccHHHHHHccccccHHHHHcccccEEEEEccccEEEEEccHHHHHHHHHHHHHcccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHcc
cccccEEEEEcccccHHHHcccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccEEEEccccccHHHHHccEEcHHHHHHccccEEEEccccccEEccccHHHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHcc
mespnllvasgsklvsggmrknptlicvpimgeSVDKMVVDMGKANASGADLVEIRLdglknfnpreniktlikespvptlftyrpiweggqydgdeneRVDVLRLAMELGADYIDVELQVAREFNdsirgkkpekcKVIVSshnyqytpsveDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAkfggfltfgtlengivsapgqptiKDLLDLYnfrqmgpdtkvfgiigkpvghskspilyneafksvgfNGVFVHLLVDDIAKFFQtyssndfagfsctiphkeaavkccDEVDTVAKSIGAVNciirrqsdgklfgyntdyvGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL
mespnllvasgsklvsggmrknpTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGlknfnpreniktlikespvptlFTYRpiweggqydgdeNERVDVLRLAMELGADYIDVELQVAREfndsirgkkpekCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKsigavnciirrqsdgklfgYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALaygakakgarvVIANRTYENLQRL
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIgaggagkalaygakakgaRVVIANRTYENLQRL
*********************NPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTY******
**********************PTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENG*VSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYEN****
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL
***PNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRG*********SALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYEN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
Q9SQT8 603 Bifunctional 3-dehydroqui yes no 1.0 0.696 0.734 1e-169
Q74ZZ1 1577 Pentafunctional AROM poly yes no 0.897 0.239 0.285 9e-36
Q6CJC4 1578 Pentafunctional AROM poly yes no 0.845 0.224 0.315 4e-35
C5DN02 1579 Pentafunctional AROM poly yes no 0.852 0.226 0.302 4e-34
Q6FIV4 1579 Pentafunctional AROM poly yes no 0.854 0.227 0.317 2e-33
C5FQ73 1571 Pentafunctional AROM poly N/A no 0.878 0.234 0.296 7e-33
C4R4R8 1545 Pentafunctional AROM poly yes no 0.85 0.231 0.326 1e-32
Q9P7R0 1573 Pentafunctional AROM poly yes no 0.842 0.225 0.310 7e-32
P08566 1588 Pentafunctional AROM poly yes no 0.85 0.224 0.289 3e-31
C8Z543 1588 Pentafunctional AROM poly N/A no 0.85 0.224 0.289 3e-31
>sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=EMB3004 PE=1 SV=1 Back     alignment and function desciption
 Score =  595 bits (1535), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/425 (73%), Positives = 358/425 (84%), Gaps = 5/425 (1%)

Query: 1   MESPNLLVASGS---KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRL 57
           ME  N+ VAS S   ++ S  + KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRL
Sbjct: 68  MEPSNVYVASNSTEMEIGSHDIVKNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRL 127

Query: 58  DGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDV 117
           D LK+FNP E++KT+IK+SP+PTLFTYRP WEGGQY+GDENER DVLRLAMELGADYIDV
Sbjct: 128 DWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDV 187

Query: 118 ELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTAL 177
           ELQVA EF  SI GKKP K KVIVSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+
Sbjct: 188 ELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAV 247

Query: 178 DITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTI 237
           DI DVAR+F IT  +QVP IGLVMGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTI
Sbjct: 248 DIADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTI 307

Query: 238 KDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFF 297
           KDLLDLYNFR++GPDTKV+GIIGKPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F 
Sbjct: 308 KDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFL 367

Query: 298 QTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGA 357
           Q YSS+DFAGFSCTIPHKEAA++CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+
Sbjct: 368 QAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGS 427

Query: 358 ISAIEDGLR--GRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYE 415
           ISAIEDGLR  G  +     SS LA K  VVIGAGGAGKALAYGAK KGA+VVIANRTYE
Sbjct: 428 ISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYE 487

Query: 416 NLQRL 420
               L
Sbjct: 488 RALEL 492





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 5
>sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 Back     alignment and function description
>sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FIV4|ARO1_CANGA Pentafunctional AROM polypeptide OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 Back     alignment and function description
>sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aro1 PE=3 SV=1 Back     alignment and function description
>sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 Back     alignment and function description
>sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
255551621 539 shikimate dehydrogenase, putative [Ricin 0.961 0.749 0.821 0.0
224107417 538 dehydroquinate dehydratase/ shikimate de 0.964 0.752 0.819 0.0
359477446 522 PREDICTED: bifunctional 3-dehydroquinate 0.964 0.775 0.803 0.0
58047529508 3-dehydroquinate dehydratase/shikimate 5 0.945 0.781 0.808 1e-179
356495945 527 PREDICTED: bifunctional 3-dehydroquinate 0.990 0.789 0.757 1e-176
76782194 536 putative 3-dehydroquinate dehydratase/sh 0.985 0.772 0.756 1e-176
297736925495 unnamed protein product [Vitis vinifera] 0.911 0.773 0.812 1e-174
281193024 526 dehydroquinate dehydratase [Solanum tube 0.980 0.783 0.748 1e-172
449503035 542 PREDICTED: bifunctional 3-dehydroquinate 0.954 0.739 0.768 1e-171
397911050377 shikimate dehydrogenase, partial [Gunner 0.895 0.997 0.805 1e-171
>gi|255551621|ref|XP_002516856.1| shikimate dehydrogenase, putative [Ricinus communis] gi|223543944|gb|EEF45470.1| shikimate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/404 (82%), Positives = 364/404 (90%)

Query: 17  GGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKES 76
           GG+RKNPTLIC PIM +SVDKM++++ KA  +GADLVEIRLD LK FN  ++IKTLI  S
Sbjct: 25  GGLRKNPTLICAPIMADSVDKMLINLVKAKENGADLVEIRLDSLKTFNASDDIKTLITRS 84

Query: 77  PVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEK 136
           P+PTLFTYRP WEGG+YDGDENER+D LRLAMELGADYIDVEL+VA +FNDSIRG KP K
Sbjct: 85  PLPTLFTYRPKWEGGEYDGDENERLDALRLAMELGADYIDVELKVAHKFNDSIRGNKPAK 144

Query: 137 CKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPI 196
           CKVIVSSHNY  TPSVEDL NLVA IQA+GADIVK ATTALDITDVAR+FQITVHSQVPI
Sbjct: 145 CKVIVSSHNYHNTPSVEDLGNLVADIQAAGADIVKIATTALDITDVARIFQITVHSQVPI 204

Query: 197 IGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVF 256
           IG+VMGERGLISRILCAKFGG+LTFGTLE+GIVSAPGQP IKDLLDLYNFRQ+GPDTKV+
Sbjct: 205 IGIVMGERGLISRILCAKFGGYLTFGTLESGIVSAPGQPMIKDLLDLYNFRQIGPDTKVY 264

Query: 257 GIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKE 316
           GIIGKPVGHSKSP+LYNEAFKSVGFNGV+VHLLVDDIA F QT+SS DFAGFSCTIPHKE
Sbjct: 265 GIIGKPVGHSKSPVLYNEAFKSVGFNGVYVHLLVDDIASFLQTFSSTDFAGFSCTIPHKE 324

Query: 317 AAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVS 376
           AAV CCD +D+VA+SIGAVNCIIRRQ DGKLFGYNTDY GAI+AIE+GLR   N+SG   
Sbjct: 325 AAVDCCDGIDSVARSIGAVNCIIRRQRDGKLFGYNTDYDGAITAIEEGLRVSQNISGAAD 384

Query: 377 SALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL 420
           S LAGKLFVVIGAGGAGKALAYGAK KGA+VVIANRTYE  + L
Sbjct: 385 SPLAGKLFVVIGAGGAGKALAYGAKQKGAKVVIANRTYERAKGL 428




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224107417|ref|XP_002314474.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222863514|gb|EEF00645.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359477446|ref|XP_002277395.2| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|58047529|gb|AAW65140.1| 3-dehydroquinate dehydratase/shikimate 5-dehydrogenase [Juglans regia] Back     alignment and taxonomy information
>gi|356495945|ref|XP_003516831.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|76782194|gb|ABA54867.1| putative 3-dehydroquinate dehydratase/shikimate dehydrogenase [Fagus sylvatica] Back     alignment and taxonomy information
>gi|297736925|emb|CBI26126.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|281193024|gb|ADA57640.1| dehydroquinate dehydratase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|449503035|ref|XP_004161812.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|397911050|gb|AFO68801.1| shikimate dehydrogenase, partial [Gunnera manicata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
TAIR|locus:2081036 603 MEE32 "MATERNAL EFFECT EMBRYO 1.0 0.696 0.694 2.3e-151
SGD|S000002534 1588 ARO1 "Pentafunctional arom pro 0.776 0.205 0.292 1e-28
TIGR_CMR|CBU_2075233 CBU_2075 "3-dehydroquinate deh 0.511 0.922 0.32 5e-28
POMBASE|SPAC1834.02 1573 aro1 "pentafunctional aromatic 0.745 0.198 0.315 8.3e-27
ASPGD|ASPL0000055969 1583 aromA [Emericella nidulans (ta 0.740 0.196 0.303 9.3e-22
CGD|CAL0004346 1551 ARO1 [Candida albicans (taxid: 0.842 0.228 0.276 1.6e-21
TIGR_CMR|DET_0466222 DET_0466 "3-dehydroquinate deh 0.497 0.941 0.325 7.5e-21
TIGR_CMR|BA_4561 308 BA_4561 "shikimate 5-dehydroge 0.254 0.347 0.378 2.6e-17
TIGR_CMR|CHY_0623 280 CHY_0623 "shikimate 5-dehydrog 0.371 0.557 0.315 1.4e-16
UNIPROTKB|P05194252 aroD "AroD" [Escherichia coli 0.507 0.845 0.277 1.9e-16
TAIR|locus:2081036 MEE32 "MATERNAL EFFECT EMBRYO ARREST 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1477 (525.0 bits), Expect = 2.3e-151, P = 2.3e-151
 Identities = 295/425 (69%), Positives = 341/425 (80%)

Query:     1 MESPNLLVASGS---KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRL 57
             ME  N+ VAS S   ++ S  + KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRL
Sbjct:    68 MEPSNVYVASNSTEMEIGSHDIVKNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRL 127

Query:    58 DGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDV 117
             D LK+FNP E++KT+IK+SP+PTLFTYRP WEGGQY+GDENER DVLRLAMELGADYIDV
Sbjct:   128 DWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDV 187

Query:   118 ELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTAL 177
             ELQVA EF  SI GKKP K KVIVSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+
Sbjct:   188 ELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAV 247

Query:   178 DITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTI 237
             DI DVAR+F IT  +QVP IGLVMGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTI
Sbjct:   248 DIADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTI 307

Query:   238 KDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFF 297
             KDLLDLYNFR++GPDTKV+GIIGKPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F 
Sbjct:   308 KDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFL 367

Query:   298 QTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGA 357
             Q YSS+DFAGFSCTIPHKEAA++CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+
Sbjct:   368 QAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGS 427

Query:   358 ISAIEDGLRGRLNVSG--GVSSALAGKLFVVIXXXXXXXXXXXXXXXXXXRVVIANRTYE 415
             ISAIEDGLR   + S     SS LA K  VVI                  +VVIANRTYE
Sbjct:   428 ISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYE 487

Query:   416 NLQRL 420
                 L
Sbjct:   488 RALEL 492




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003855 "3-dehydroquinate dehydratase activity" evidence=IEA;IDA
GO:0004764 "shikimate 3-dehydrogenase (NADP+) activity" evidence=IEA;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0019632 "shikimate metabolic process" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
SGD|S000002534 ARO1 "Pentafunctional arom protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2075 CBU_2075 "3-dehydroquinate dehydratase, type I" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
POMBASE|SPAC1834.02 aro1 "pentafunctional aromatic polypeptide Aro1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000055969 aromA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0004346 ARO1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0466 DET_0466 "3-dehydroquinate dehydratase, type I" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4561 BA_4561 "shikimate 5-dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0623 CHY_0623 "shikimate 5-dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P05194 aroD "AroD" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SQT8DHQSD_ARATH1, ., 1, ., 1, ., 2, 50.73411.00.6965yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.100.946
3rd Layer1.1.10.963
3rd Layer4.2.10.963
4th Layer1.1.1.250.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
DHQD4
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
DHQS6
SubName- Full=Putative uncharacterized protein; (375 aa)
   0.971
SK2
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.932
SK3
shikimate kinase (EC-2.7.1.71) (294 aa)
     0.931
SKp
shikimate kinase (EC-2.7.1.71) (223 aa)
      0.927
SK1
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.920
DHQD5
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (504 aa)
     0.903
DHQD3
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
DHQD1
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
DHQD2
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (521 aa)
     0.901
EPSPS
3-phosphoshikimate 1-carboxyvinyltransferase (EC-2.5.1.19) (519 aa)
    0.751

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
PLN02520 529 PLN02520, PLN02520, bifunctional 3-dehydroquinate 0.0
pfam01487222 pfam01487, DHquinase_I, Type I 3-dehydroquinase 3e-84
TIGR01093228 TIGR01093, aroD, 3-dehydroquinate dehydratase, typ 5e-73
cd00502225 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-deh 4e-66
COG0710231 COG0710, AroD, 3-dehydroquinate dehydratase [Amino 3e-53
COG0169 283 COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac 2e-49
PRK00258 278 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewe 3e-48
PRK09310 477 PRK09310, aroDE, bifunctional 3-dehydroquinate deh 9e-42
PRK02412253 PRK02412, aroD, 3-dehydroquinate dehydratase; Prov 3e-41
TIGR00507 270 TIGR00507, aroE, shikimate 5-dehydrogenase 7e-36
pfam0850183 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase 8e-29
PRK13575238 PRK13575, PRK13575, 3-dehydroquinate dehydratase; 1e-25
PRK12548 289 PRK12548, PRK12548, shikimate 5-dehydrogenase; Pro 2e-22
TIGR01809 282 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase 3e-21
PRK12749 288 PRK12749, PRK12749, quinate/shikimate dehydrogenas 1e-13
PRK12549 284 PRK12549, PRK12549, shikimate 5-dehydrogenase; Rev 1e-13
cd01065155 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom 9e-10
PRK14027 283 PRK14027, PRK14027, quinate/shikimate dehydrogenas 4e-09
pfam01488133 pfam01488, Shikimate_DH, Shikimate / quinate 5-deh 1e-08
PRK12550272 PRK12550, PRK12550, shikimate 5-dehydrogenase; Rev 3e-07
PRK13576216 PRK13576, PRK13576, 3-dehydroquinate dehydratase; 1e-06
PRK00045 423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 4e-04
PRK07890 258 PRK07890, PRK07890, short chain dehydrogenase; Pro 0.001
COG0373 414 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m 0.003
cd00401 402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 0.003
>gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
 Score =  798 bits (2064), Expect = 0.0
 Identities = 336/418 (80%), Positives = 367/418 (87%), Gaps = 1/418 (0%)

Query: 3   SPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKN 62
                +AS     SGG+R+NPTLICVPIM +SVDKM+++M KA   GADLVEIRLD LKN
Sbjct: 2   VSTASLASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKN 61

Query: 63  FNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVA 122
           FNPRE++KTLIK+SP+PTL TYRP WEGGQY+GDEN+R D LRLAMELGADY+DVEL+VA
Sbjct: 62  FNPREDLKTLIKQSPLPTLVTYRPKWEGGQYEGDENKRQDALRLAMELGADYVDVELKVA 121

Query: 123 REFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDV 182
            EF +SI GKKPEKCKVIVSSHNY+ TPSVE+L NLVARIQA+GADIVK ATTALDITDV
Sbjct: 122 HEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGADIVKIATTALDITDV 181

Query: 183 ARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLD 242
           AR+FQITVHSQVP IGLVMGERGLISRILC KFGG+LTFGTLE G VSAPGQPTIKDLLD
Sbjct: 182 ARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLD 241

Query: 243 LYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSS 302
           LYNFRQ+GPDTKV+GIIGKPVGHSKSPIL+NEAFKSVGFNGV+VHLLVDD+AKF QTYSS
Sbjct: 242 LYNFRQIGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSS 301

Query: 303 NDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIE 362
            DFAGFSCTIPHKE A+KCCDEVD +AKSIGA+N IIRR SDGKL GYNTDY+GAISAIE
Sbjct: 302 PDFAGFSCTIPHKEDALKCCDEVDPIAKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIE 361

Query: 363 DGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL 420
           DGLR     S    S LAGKLFVVIGAGGAGKALAYGAK KGARVVIANRTYE  + L
Sbjct: 362 DGLRA-SGSSPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKEL 418


Length = 529

>gnl|CDD|216526 pfam01487, DHquinase_I, Type I 3-dehydroquinase Back     alignment and domain information
>gnl|CDD|233268 TIGR01093, aroD, 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>gnl|CDD|188633 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase) Back     alignment and domain information
>gnl|CDD|223782 COG0710, AroD, 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234703 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|137204 PRK09310, aroDE, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>gnl|CDD|235036 PRK02412, aroD, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|149523 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase substrate binding domain Back     alignment and domain information
>gnl|CDD|184156 PRK13575, PRK13575, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|183585 PRK12548, PRK12548, shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233580 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>gnl|CDD|183721 PRK12749, PRK12749, quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183586 PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>gnl|CDD|172521 PRK14027, PRK14027, quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|183587 PRK12550, PRK12550, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237433 PRK13576, PRK13576, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 100.0
PRK09310 477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 100.0
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 100.0
COG0710231 AroD 3-dehydroquinate dehydratase [Amino acid tran 100.0
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 100.0
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 100.0
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 100.0
PRK13575238 3-dehydroquinate dehydratase; Provisional 100.0
PRK13576216 3-dehydroquinate dehydratase; Provisional 100.0
PRK01261229 aroD 3-dehydroquinate dehydratase; Provisional 100.0
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 100.0
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 100.0
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 100.0
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 100.0
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 100.0
PRK12548 289 shikimate 5-dehydrogenase; Provisional 100.0
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 100.0
PRK12550 272 shikimate 5-dehydrogenase; Reviewed 100.0
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 100.0
KOG0692 595 consensus Pentafunctional AROM protein [Amino acid 99.96
PF0850183 Shikimate_dh_N: Shikimate dehydrogenase substrate 99.95
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.79
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.81
PRK08291 330 ectoine utilization protein EutC; Validated 98.61
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 98.49
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.38
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 98.16
PRK13940 414 glutamyl-tRNA reductase; Provisional 98.13
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.03
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.91
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.51
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.36
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 97.25
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.2
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.14
PLN00203 519 glutamyl-tRNA reductase 97.09
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.08
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.03
PRK14194 301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.79
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.78
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.68
PRK08306 296 dipicolinate synthase subunit A; Reviewed 96.64
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.4
PRK06141 314 ornithine cyclodeaminase; Validated 96.31
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.29
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.23
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.22
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 96.19
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 96.14
PRK08328 231 hypothetical protein; Provisional 96.13
PRK07340 304 ornithine cyclodeaminase; Validated 96.09
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.04
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 95.95
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.94
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 95.88
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.84
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.81
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.73
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 95.73
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.72
PRK08618 325 ornithine cyclodeaminase; Validated 95.71
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 95.63
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 95.6
PRK05866 293 short chain dehydrogenase; Provisional 95.52
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.52
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 95.51
PF02826 178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.49
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.45
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.4
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.39
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.38
PRK12331448 oxaloacetate decarboxylase; Provisional 95.36
PRK14982 340 acyl-ACP reductase; Provisional 95.36
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 95.35
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.35
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 95.31
PRK12330499 oxaloacetate decarboxylase; Provisional 95.29
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.28
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 95.24
PRK06196 315 oxidoreductase; Provisional 95.23
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.16
PLN02780 320 ketoreductase/ oxidoreductase 95.13
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.1
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.08
PRK15116 268 sulfur acceptor protein CsdL; Provisional 95.04
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.01
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.94
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 94.9
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 94.87
PRK14041467 oxaloacetate decarboxylase; Provisional 94.87
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 94.79
PRK11572248 copper homeostasis protein CutC; Provisional 94.76
PLN02494 477 adenosylhomocysteinase 94.75
PRK08223 287 hypothetical protein; Validated 94.66
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 94.64
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 94.6
PRK09282 592 pyruvate carboxylase subunit B; Validated 94.59
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.58
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.52
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 94.5
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.44
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 94.44
KOG1208 314 consensus Dehydrogenases with different specificit 94.44
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.42
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.38
PTZ00075 476 Adenosylhomocysteinase; Provisional 94.3
PRK06153 393 hypothetical protein; Provisional 94.29
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 94.26
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.22
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 94.14
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 94.06
PF01262 168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.05
PLN03209 576 translocon at the inner envelope of chloroplast su 94.01
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 93.99
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.99
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.97
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.95
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 93.93
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.93
PRK12779 944 putative bifunctional glutamate synthase subunit b 93.9
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.9
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 93.89
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.8
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.72
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 93.72
PRK06567 1028 putative bifunctional glutamate synthase subunit b 93.72
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 93.71
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.7
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.65
PRK14040 593 oxaloacetate decarboxylase; Provisional 93.61
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 93.59
PRK13243 333 glyoxylate reductase; Reviewed 93.54
PLN02928 347 oxidoreductase family protein 93.53
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.53
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.52
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 93.44
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 93.42
PRK12480 330 D-lactate dehydrogenase; Provisional 93.32
PRK07411 390 hypothetical protein; Validated 93.32
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 93.3
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 93.17
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 93.11
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.1
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 93.08
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.04
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.03
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 93.02
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 93.02
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 93.01
COG1179 263 Dinucleotide-utilizing enzymes involved in molybdo 92.93
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 92.91
PRK12581468 oxaloacetate decarboxylase; Provisional 92.82
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 92.8
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.74
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 92.72
PRK06484 520 short chain dehydrogenase; Validated 92.66
PRK12831 464 putative oxidoreductase; Provisional 92.64
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 92.63
PRK14031 444 glutamate dehydrogenase; Provisional 92.57
PRK11613282 folP dihydropteroate synthase; Provisional 92.53
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 92.51
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 92.47
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 92.46
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 92.44
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 92.4
PRK06701 290 short chain dehydrogenase; Provisional 92.39
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.37
PLN02852 491 ferredoxin-NADP+ reductase 92.35
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 92.26
PRK07201 657 short chain dehydrogenase; Provisional 92.26
PRK08324 681 short chain dehydrogenase; Validated 92.25
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.21
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 92.17
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 92.15
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 92.15
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 92.13
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 92.11
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 92.08
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 92.05
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 92.05
PRK07985 294 oxidoreductase; Provisional 92.01
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.97
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 91.95
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.93
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.91
PRK05855 582 short chain dehydrogenase; Validated 91.86
PRK06128 300 oxidoreductase; Provisional 91.84
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 91.83
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 91.83
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 91.79
PRK12814 652 putative NADPH-dependent glutamate synthase small 91.79
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.74
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 91.74
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 91.72
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 91.72
PRK05562 223 precorrin-2 dehydrogenase; Provisional 91.67
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 91.66
PLN02602 350 lactate dehydrogenase 91.58
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 91.56
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 91.56
PRK05581220 ribulose-phosphate 3-epimerase; Validated 91.54
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 91.54
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 91.52
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 91.51
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 91.5
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 91.43
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 91.43
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 91.33
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 91.23
PRK07226267 fructose-bisphosphate aldolase; Provisional 91.22
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 91.22
PF00682237 HMGL-like: HMGL-like of this family is not conserv 91.15
PRK14851 679 hypothetical protein; Provisional 91.11
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 91.08
PTZ00245 287 ubiquitin activating enzyme; Provisional 91.08
PRK06046 326 alanine dehydrogenase; Validated 91.07
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 91.04
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 91.02
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 90.98
COG1635 262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 90.92
PRK07574 385 formate dehydrogenase; Provisional 90.89
PRK06436 303 glycerate dehydrogenase; Provisional 90.86
PLN02686 367 cinnamoyl-CoA reductase 90.85
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 90.79
PRK04148134 hypothetical protein; Provisional 90.78
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.75
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 90.68
PLN02477 410 glutamate dehydrogenase 90.66
PRK08605 332 D-lactate dehydrogenase; Validated 90.61
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 90.58
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 90.55
PRK07226267 fructose-bisphosphate aldolase; Provisional 90.48
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 90.44
PLN03139 386 formate dehydrogenase; Provisional 90.42
PRK14042 596 pyruvate carboxylase subunit B; Provisional 90.37
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 90.37
PRK13984 604 putative oxidoreductase; Provisional 90.36
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 90.34
PRK12862 763 malic enzyme; Reviewed 90.32
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.31
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 90.15
PRK09496 453 trkA potassium transporter peripheral membrane com 90.1
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 90.1
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 90.08
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 90.01
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 89.94
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 89.82
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 89.81
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 89.79
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.74
PLN02256 304 arogenate dehydrogenase 89.58
PRK06487 317 glycerate dehydrogenase; Provisional 89.51
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 89.45
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 89.42
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 89.34
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 89.3
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 89.28
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 89.22
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 89.2
PLN02463 447 lycopene beta cyclase 89.18
PRK11730 715 fadB multifunctional fatty acid oxidation complex 89.14
PRK06199 379 ornithine cyclodeaminase; Validated 89.12
PRK14852 989 hypothetical protein; Provisional 89.11
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 89.03
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 89.02
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 89.01
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 89.01
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 89.01
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 88.96
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 88.95
PRK13523337 NADPH dehydrogenase NamA; Provisional 88.94
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 88.93
PLN02985 514 squalene monooxygenase 88.91
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 88.85
PRK06823 315 ornithine cyclodeaminase; Validated 88.85
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 88.83
PTZ00188 506 adrenodoxin reductase; Provisional 88.81
PLN02572 442 UDP-sulfoquinovose synthase 88.78
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 88.73
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 88.71
PRK08132 547 FAD-dependent oxidoreductase; Provisional 88.7
PRK06932 314 glycerate dehydrogenase; Provisional 88.59
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 88.58
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.55
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 88.54
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 88.5
PRK14030 445 glutamate dehydrogenase; Provisional 88.43
TIGR00190423 thiC thiamine biosynthesis protein ThiC. The thiC 88.4
PRK06407 301 ornithine cyclodeaminase; Provisional 88.37
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 88.34
PLN02740 381 Alcohol dehydrogenase-like 88.19
COG0476 254 ThiF Dinucleotide-utilizing enzymes involved in mo 88.15
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 88.1
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 88.0
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 88.0
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 87.94
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 87.93
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 87.92
PRK13352431 thiamine biosynthesis protein ThiC; Provisional 87.91
PRK12999 1146 pyruvate carboxylase; Reviewed 87.9
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 87.89
PRK07589 346 ornithine cyclodeaminase; Validated 87.81
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 87.67
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 87.6
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 87.55
PF02423 313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 87.55
KOG2018 430 consensus Predicted dinucleotide-utilizing enzyme 87.51
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 87.49
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 87.46
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 87.42
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 87.41
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 87.4
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 87.39
TIGR01496257 DHPS dihydropteroate synthase. This model represen 87.38
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 87.31
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 87.27
TIGR02371 325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 87.22
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 87.21
PRK09414 445 glutamate dehydrogenase; Provisional 87.17
TIGR01496257 DHPS dihydropteroate synthase. This model represen 87.08
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 86.99
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 86.74
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 86.68
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 86.68
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 86.68
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 86.66
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 86.57
PLN02712 667 arogenate dehydrogenase 86.5
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 86.45
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 86.42
PTZ00367 567 squalene epoxidase; Provisional 86.33
PRK09284607 thiamine biosynthesis protein ThiC; Provisional 86.32
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 86.31
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 86.31
PLN02444642 HMP-P synthase 86.24
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 86.16
PLN02306 386 hydroxypyruvate reductase 86.11
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 86.1
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 86.1
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 86.06
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 85.98
PRK00507221 deoxyribose-phosphate aldolase; Provisional 85.96
PLN02334229 ribulose-phosphate 3-epimerase 85.88
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 85.74
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 85.66
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 85.62
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 85.6
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 85.51
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 85.5
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 85.5
KOG0069 336 consensus Glyoxylate/hydroxypyruvate reductase (D- 85.43
PRK08294 634 phenol 2-monooxygenase; Provisional 85.42
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 85.42
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 85.41
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 85.33
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 85.28
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 85.21
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 85.19
PRK02227238 hypothetical protein; Provisional 85.15
PRK13977 576 myosin-cross-reactive antigen; Provisional 85.1
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 85.07
COG0281 432 SfcA Malic enzyme [Energy production and conversio 85.06
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 85.03
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 85.02
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 84.95
KOG0409 327 consensus Predicted dehydrogenase [General functio 84.73
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 84.61
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 84.58
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 84.51
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 84.46
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 84.44
PRK10669 558 putative cation:proton antiport protein; Provision 84.42
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 84.4
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 84.39
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 84.38
PLN02586 360 probable cinnamyl alcohol dehydrogenase 84.36
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 84.35
PLN02342 348 ornithine carbamoyltransferase 84.21
PLN02827 378 Alcohol dehydrogenase-like 84.15
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 84.06
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 84.06
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 84.0
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 83.99
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 83.96
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 83.79
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 83.76
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 83.75
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 83.69
PRK12831 464 putative oxidoreductase; Provisional 83.68
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 83.67
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 83.63
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 83.61
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 83.61
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 83.59
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 83.54
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 83.5
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 83.48
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 83.44
PLN02697 529 lycopene epsilon cyclase 83.3
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 83.26
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 83.23
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 83.2
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 83.18
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 83.17
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 83.12
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 83.11
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 83.03
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 82.94
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 82.93
PLN02661 357 Putative thiazole synthesis 82.86
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 82.86
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 82.81
PRK04165450 acetyl-CoA decarbonylase/synthase complex subunit 82.68
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 82.66
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 82.57
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 82.55
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 82.54
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 82.48
KOG2015 422 consensus NEDD8-activating complex, catalytic comp 82.42
PF01964420 ThiC: ThiC family; InterPro: IPR002817 ThiC is fou 82.41
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 82.32
PTZ00058 561 glutathione reductase; Provisional 82.28
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 82.18
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 82.1
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 82.1
PRK13748 561 putative mercuric reductase; Provisional 82.01
cd05284 340 arabinose_DH_like D-arabinose dehydrogenase. This 81.99
PLN02695 370 GDP-D-mannose-3',5'-epimerase 81.97
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 81.96
PLN02514 357 cinnamyl-alcohol dehydrogenase 81.78
PLN02487 569 zeta-carotene desaturase 81.77
PLN02712 667 arogenate dehydrogenase 81.72
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 81.68
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 81.6
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 81.59
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 81.52
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 81.51
PLN02464 627 glycerol-3-phosphate dehydrogenase 81.41
COG2423 330 Predicted ornithine cyclodeaminase, mu-crystallin 81.4
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 81.31
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 81.06
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 81.02
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 80.85
PRK08227264 autoinducer 2 aldolase; Validated 80.81
PLN00112 444 malate dehydrogenase (NADP); Provisional 80.8
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 80.73
KOG2017 427 consensus Molybdopterin synthase sulfurylase [Coen 80.53
PRK00856 305 pyrB aspartate carbamoyltransferase catalytic subu 80.45
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 80.44
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 80.4
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 80.39
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 80.33
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 80.12
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=3.6e-101  Score=809.76  Aligned_cols=411  Identities=82%  Similarity=1.248  Sum_probs=374.7

Q ss_pred             cccccccccCCCCCCcEEEEeecCCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCC
Q 014691            9 ASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIW   88 (420)
Q Consensus         9 ~~~~~~~~~~~~~~~~~icv~l~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~   88 (420)
                      ||.---|||+|++++|+|||||++++.+|++.+++++...++|+||||+|+|.+..+.+++..+++..++|+|||+|+++
T Consensus         8 ~~~~~~~~~~~~~~~~~icv~i~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~~~~~~~~~~~plI~T~R~~~   87 (529)
T PLN02520          8 ASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKNFNPREDLKTLIKQSPLPTLVTYRPKW   87 (529)
T ss_pred             hhhhhhcccccccCCCEEEEEeCCCCHHHHHHHHHHhhhcCCCEEEEEeccccccCCHHHHHHHHhcCCCcEEEEeccHH
Confidence            45555689999999999999999999999999999887789999999999998766556677777777899999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCcEEEEEcccccchhHHHhhcCCCCcEEEEEcccCCCCCCHHHHHHHHHHHHHcCCC
Q 014691           89 EGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGAD  168 (420)
Q Consensus        89 eGG~~~~~~~~~~~ll~~~~~~~~d~iDiEl~~~~~~~~~l~~~~~~~~kiI~S~H~f~~tP~~~el~~~~~~~~~~gaD  168 (420)
                      |||.|++++++|+++|+.+++.++||||||+...++..+.+...+..+++||+|||||++||+.+|+.+++++|.++|||
T Consensus        88 eGG~~~~~~~~~~~ll~~~~~~~~d~iDiEl~~~~~~~~~~~~~~~~~~~vI~S~H~f~~tP~~~el~~~~~~~~~~gaD  167 (529)
T PLN02520         88 EGGQYEGDENKRQDALRLAMELGADYVDVELKVAHEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGAD  167 (529)
T ss_pred             HCCCCCCCHHHHHHHHHHHHHhCCCEEEEEcCCchhHHHHHHhhhhcCCEEEEEecCCCCCCCHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999888766666556668999999999999999999999999999999999


Q ss_pred             EEEEEeecCCHHHHHHHHHHhccCCCCEEEEecCCcchhhhhhccccCCcccccccCCCccCCCCCCCHHhHHHHHhccc
Q 014691          169 IVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQ  248 (420)
Q Consensus       169 ivKia~~~~s~~D~~~ll~~~~~~~~p~I~~~MG~~G~~SRi~~~~~Gs~ltf~~~~~~~~sAPGQ~~~~~l~~~~~~~~  248 (420)
                      |+|||+||++.+|++++++++.+.+.|+|+||||+.|++||+++++|||++||++++.+.++||||+++++++++|++.+
T Consensus       168 i~Kia~~~~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~GS~lTy~~~~~~~~sAPGQ~~~~~l~~~~~~~~  247 (529)
T PLN02520        168 IVKIATTALDITDVARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLDLYNFRQ  247 (529)
T ss_pred             EEEEecCCCCHHHHHHHHHHHhhcCCCEEEEecCCCCchheecccccCCceeeeecCcccccCCCCCCHHHHHHHhhhhc
Confidence            99999999999999999998877789999999999999999999999999999999865579999999999999999999


Q ss_pred             cCCCceEEeeeccCccccccHHHHHHHHHHcCCCceeeccccccHHHHHHHhcCCCCCEEEEcccchHHHHhhhhcccHH
Q 014691          249 MGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTV  328 (420)
Q Consensus       249 ~~~~~~~~~v~G~pv~hS~SP~ihn~~f~~~gl~~~y~~~~~~~l~~~~~~~~~~~~~G~~VT~P~K~~i~~~~d~l~~~  328 (420)
                      ++++|++|||+|+||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||+++++++|++|+.
T Consensus       248 ~~~~t~~~~liG~Pi~hS~SP~ihn~~f~~~gl~~~Y~~~~v~~l~~~~~~l~~~~~~G~nVTiP~K~~v~~~lD~~~~~  327 (529)
T PLN02520        248 IGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSSPDFAGFSCTIPHKEDALKCCDEVDPI  327 (529)
T ss_pred             ccCCceEEEEEcCCcccccCHHHHHHHHHHCCCCcEEEEeehhhHHHHHHHHhhCCCCEEEECcCCHHHHHHHhccCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcceeEEEEeccCCeEEEEecCHHHHHHHHHhhhccCCCCCCCcccccCCCEEEEEccchHHHHHHHHHHhCCCeEE
Q 014691          329 AKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVV  408 (420)
Q Consensus       329 A~~iGAvNTi~~~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~~~~~~~~~k~vlviGaGGaara~~~aL~~~g~~i~  408 (420)
                      |+.+||||||++++++|+|+||||||.||+.+|++.+...+. .+..+.++++|+++|+|+||+|||++++|++.|++|+
T Consensus       328 A~~iGAVNTvv~~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~-~~~~~~~~~~k~vlIlGaGGagrAia~~L~~~G~~V~  406 (529)
T PLN02520        328 AKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIEDGLRASGS-SPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVV  406 (529)
T ss_pred             HHHhCCceEEEEeCCCCEEEEEcccHHHHHHHHHhhhccccc-ccccccCCCCCEEEEECCcHHHHHHHHHHHHCCCEEE
Confidence            999999999998622799999999999999999864311000 0001245788999999999999999999999999999


Q ss_pred             EEeCChhhhhcC
Q 014691          409 IANRTYENLQRL  420 (420)
Q Consensus       409 v~nR~~~ka~~L  420 (420)
                      ++||+.+++++|
T Consensus       407 i~nR~~e~a~~l  418 (529)
T PLN02520        407 IANRTYERAKEL  418 (529)
T ss_pred             EEcCCHHHHHHH
Confidence            999999988753



>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>COG0710 AroD 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>PRK13575 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK13576 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG0692 consensus Pentafunctional AROM protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00190 thiC thiamine biosynthesis protein ThiC Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13352 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09284 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PLN02444 HMP-P synthase Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01964 ThiC: ThiC family; InterPro: IPR002817 ThiC is found within the thiamin biosynthesis operon Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
2gpt_A 523 Crystal Structure Of Arabidopsis Dehydroquinate Deh 1e-165
2o7q_A 523 Crystal Structure Of The A. Thaliana Dhq-Dehydroshi 1e-164
3js3_A258 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 5e-22
1nvt_A 287 Crystal Structure Of Shikimate Dehydrogenase (Aroe 3e-19
3l2i_A276 1.85 Angstrom Crystal Structure Of The 3-Dehydroqui 3e-19
3m7w_A255 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 4e-19
2egg_A 297 Crystal Structure Of Shikimate 5-Dehydrogenase (Aro 1e-18
4guf_A276 1.5 Angstrom Crystal Structure Of The Salmonella En 2e-18
3nnt_A276 Crystal Structure Of K170m Mutant Of Type I 3-Dehyd 2e-18
3o1n_A276 1.03 Angstrom Crystal Structure Of Q236a Mutant Typ 2e-18
1qfe_A252 The Structure Of Type I 3-Dehydroquinate Dehydratas 3e-18
3don_A 277 Crystal Structure Of Shikimate Dehydrogenase From S 4e-17
2hk7_A269 Crystal Structure Of Shikimate Dehydrogenase From A 5e-16
2hk9_A275 Crystal Structure Of Shikimate Dehydrogenase From A 5e-16
2ox1_A196 Archaeal Dehydroquinase Length = 196 1e-14
2yr1_A257 Crystal Structure Of 3-Dehydroquinate Dehydratase F 4e-14
1wxd_A263 Crystal Structure Of Shikimate 5-dehydrogenase (aro 5e-13
1sfl_A238 1.9a Crystal Structure Of Staphylococcus Aureus Typ 1e-12
1sfj_A238 2.4a Crystal Structure Of Staphylococcus Aureus Typ 3e-12
3u62_A253 Crystal Structure Of Shikimate Dehydrogenase From T 3e-12
2egz_A219 Crystal Structure Of The 3-Dehydroquinate Dehydrata 1e-11
4fr5_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-11
4fq8_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-11
4fos_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-11
4fpx_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-11
4foo_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-11
3phg_A269 Crystal Structure Of The Shikimate 5-Dehydrogenase 2e-11
4fsh_A271 Crystal Structure Of Shikimate Dehydrogenase (aroe) 3e-11
3toz_A 315 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehyd 3e-11
1nyt_A271 Shikimate Dehydrogenase Aroe Complexed With Nadp+ L 8e-11
3t4e_A 312 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehy 1e-10
3l9c_A259 The Crystal Structure Of Smu.777 From Streptococcus 2e-10
3fbt_A 282 Crystal Structure Of A Chorismate MutaseSHIKIMATE 5 1e-09
1npd_A 288 X-Ray Structure Of Shikimate Dehydrogenase Complexe 5e-09
1vi2_A 300 Crystal Structure Of Shikimate-5-Dehydrogenase With 6e-09
3tum_B269 2.15 Angstrom Resolution Crystal Structure Of A Shi 5e-08
2ocz_A231 The Structure Of A Putative 3-dehydroquinate Dehydr 8e-07
3o8q_A 281 1.45 Angstrom Resolution Crystal Structure Of Shiki 6e-06
1p74_A 272 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 6e-06
3pgj_A 302 2.49 Angstrom Resolution Crystal Structure Of Shiki 6e-06
3o8q_B 275 1.45 Angstrom Resolution Crystal Structure Of Shiki 8e-06
3jyo_A 283 Quinate Dehydrogenase From Corynebacterium Glutamic 2e-05
2nlo_A 302 Crystal Structure Of The Quinate Dehydrogenase From 2e-05
3pwz_A272 Crystal Structure Of An Ael1 Enzyme From Pseudomona 8e-05
1npy_A 271 Structure Of Shikimate 5-Dehydrogenase-Like Protein 1e-04
>pdb|2GPT|A Chain A, Crystal Structure Of Arabidopsis Dehydroquinate Dehydratase- Shikimate Dehydrogenase In Complex With Tartrate And Shikimate Length = 523 Back     alignment and structure

Iteration: 1

Score = 577 bits (1487), Expect = e-165, Method: Compositional matrix adjust. Identities = 287/402 (71%), Positives = 329/402 (81%), Gaps = 2/402 (0%) Query: 21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPT 80 KNP+LIC P+M +S+DKMV++ KA+ GADLVEIRLD LK+FNP E++KT+IK+SP+PT Sbjct: 2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61 Query: 81 LFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVI 140 LFTYRP WEGGQY+GDENER DVLRLAMELGADYIDVELQVA EF SI GKKP K KVI Sbjct: 62 LFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVI 121 Query: 141 VSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLV 200 VSSHNYQ TPSVEDL LVARIQ +GADIVK ATTA+DI DVAR+F IT +QVP IGLV Sbjct: 122 VSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIGLV 181 Query: 201 MGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260 MGERGL+SRILC+KFGG+LTFGTL++ VSAPGQPTIKDLLDLYNFR++GPDTKV+GIIG Sbjct: 182 MGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241 Query: 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVK 320 KPV HSKSPI++N+AFKSV FNGV+VHLLVD++ F Q YSS+DFAGFSCTIPHKEAA++ Sbjct: 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQ 301 Query: 321 CCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLR--GRLNVSGGVSSA 378 CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+ISAIEDGLR G + SS Sbjct: 302 CCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSP 361 Query: 379 LAGKLFVVIXXXXXXXXXXXXXXXXXXRVVIANRTYENLQRL 420 LA K VVI +VVIANRTYE L Sbjct: 362 LASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALEL 403
>pdb|2O7Q|A Chain A, Crystal Structure Of The A. Thaliana Dhq-Dehydroshikimate-Sdh- Shikimate-Nadp(H) Length = 523 Back     alignment and structure
>pdb|3JS3|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Clostridium Difficile With Covalent Reaction Intermediate Length = 258 Back     alignment and structure
>pdb|1NVT|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe Or Mj1084) In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|3L2I|A Chain A, 1.85 Angstrom Crystal Structure Of The 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2. Length = 276 Back     alignment and structure
>pdb|3M7W|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Covalent Complex With Dehydroquinate Length = 255 Back     alignment and structure
>pdb|2EGG|A Chain A, Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Geobacillus Kaustophilus Length = 297 Back     alignment and structure
>pdb|4GUF|A Chain A, 1.5 Angstrom Crystal Structure Of The Salmonella Enterica 3- Dehydroquinate Dehydratase (arod) E86a Mutant Length = 276 Back     alignment and structure
>pdb|3NNT|A Chain A, Crystal Structure Of K170m Mutant Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Non-Covalent Complex With Dehydroquinate. Length = 276 Back     alignment and structure
>pdb|3O1N|A Chain A, 1.03 Angstrom Crystal Structure Of Q236a Mutant Type I Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Length = 276 Back     alignment and structure
>pdb|1QFE|A Chain A, The Structure Of Type I 3-Dehydroquinate Dehydratase From Salmonella Typhi Length = 252 Back     alignment and structure
>pdb|3DON|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Staphylococcus Epidermidis Length = 277 Back     alignment and structure
>pdb|2HK7|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Mercury At 2.5 Angstrom Resolution Length = 269 Back     alignment and structure
>pdb|2HK9|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Shikimate And Nadp+ At 2.2 Angstrom Resolution Length = 275 Back     alignment and structure
>pdb|2OX1|A Chain A, Archaeal Dehydroquinase Length = 196 Back     alignment and structure
>pdb|2YR1|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From Geobacillus Kaustophilus Hta426 Length = 257 Back     alignment and structure
>pdb|1WXD|A Chain A, Crystal Structure Of Shikimate 5-dehydrogenase (aroe) From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure
>pdb|1SFL|A Chain A, 1.9a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, Apo Form Length = 238 Back     alignment and structure
>pdb|1SFJ|A Chain A, 2.4a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, With 3-Dehydroquinate Bound Length = 238 Back     alignment and structure
>pdb|3U62|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Thermotoga Maritima Length = 253 Back     alignment and structure
>pdb|2EGZ|A Chain A, Crystal Structure Of The 3-Dehydroquinate Dehydratase From Aquifex Aeolicus Vf5 Length = 219 Back     alignment and structure
>pdb|4FR5|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210s Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FQ8|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FOS|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FPX|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237n Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|4FOO|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237k Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|3PHG|A Chain A, Crystal Structure Of The Shikimate 5-Dehydrogenase (Aroe) From Helicobacter Pylori Length = 269 Back     alignment and structure
>pdb|4FSH|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (aroe) Clinical Variant V2356 From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|3TOZ|A Chain A, 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase From Listeria Monocytogenes In Complex With Nad. Length = 315 Back     alignment and structure
>pdb|1NYT|A Chain A, Shikimate Dehydrogenase Aroe Complexed With Nadp+ Length = 271 Back     alignment and structure
>pdb|3T4E|A Chain A, 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium In Complex With Nad Length = 312 Back     alignment and structure
>pdb|3L9C|A Chain A, The Crystal Structure Of Smu.777 From Streptococcus Mutans Ua159 Length = 259 Back     alignment and structure
>pdb|3FBT|A Chain A, Crystal Structure Of A Chorismate MutaseSHIKIMATE 5- Dehydrogenase Fusion Protein From Clostridium Acetobutylicum Length = 282 Back     alignment and structure
>pdb|1NPD|A Chain A, X-Ray Structure Of Shikimate Dehydrogenase Complexed With Nad+ From E.Coli (Ydib) Northeast Structural Genomics Research Consortium (Nesg) Target Er24 Length = 288 Back     alignment and structure
>pdb|1VI2|A Chain A, Crystal Structure Of Shikimate-5-Dehydrogenase With Nad Length = 300 Back     alignment and structure
>pdb|2OCZ|A Chain A, The Structure Of A Putative 3-dehydroquinate Dehydratase From Streptococcus Pyogenes Length = 231 Back     alignment and structure
>pdb|3O8Q|A Chain A, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 281 Back     alignment and structure
>pdb|1P74|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) From Haemophilus Influenzae Length = 272 Back     alignment and structure
>pdb|3PGJ|A Chain A, 2.49 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Shikimate Length = 302 Back     alignment and structure
>pdb|3O8Q|B Chain B, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 275 Back     alignment and structure
>pdb|3JYO|A Chain A, Quinate Dehydrogenase From Corynebacterium Glutamicum In Complex With Nad Length = 283 Back     alignment and structure
>pdb|2NLO|A Chain A, Crystal Structure Of The Quinate Dehydrogenase From Corynebacterium Glutamicum Length = 302 Back     alignment and structure
>pdb|3PWZ|A Chain A, Crystal Structure Of An Ael1 Enzyme From Pseudomonas Putida Length = 272 Back     alignment and structure
>pdb|1NPY|A Chain A, Structure Of Shikimate 5-Dehydrogenase-Like Protein Hi0607 Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 0.0
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 3e-72
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 1e-71
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 2e-71
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 4e-70
3js3_A258 3-dehydroquinate dehydratase; AROD, covalent react 7e-68
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 7e-68
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 2e-67
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 1e-66
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 4e-63
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 1e-62
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 7e-62
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 9e-62
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 3e-60
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 9e-58
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 1e-57
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 1e-56
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 1e-56
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 1e-54
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 2e-52
3u62_A 253 Shikimate dehydrogenase; shikimate pathway, oxidor 9e-48
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 1e-46
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 4e-46
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 6e-46
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 7e-45
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 6e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 1e-04
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-04
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 Back     alignment and structure
 Score =  545 bits (1406), Expect = 0.0
 Identities = 304/402 (75%), Positives = 346/402 (86%), Gaps = 2/402 (0%)

Query: 21  KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPT 80
           KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRLD LK+FNP E++KT+IK+SP+PT
Sbjct: 2   KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61

Query: 81  LFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVI 140
           LFTYRP WEGGQY+GDENER DVLRLAMELGADYIDVELQVA EF  SI GKKP K KVI
Sbjct: 62  LFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVI 121

Query: 141 VSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLV 200
           VSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+DI DVAR+F IT  +QVP IGLV
Sbjct: 122 VSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIGLV 181

Query: 201 MGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260
           MGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTIKDLLDLYNFR++GPDTKV+GIIG
Sbjct: 182 MGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241

Query: 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVK 320
           KPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F Q YSS+DFAGFSCTIPHKEAA++
Sbjct: 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQ 301

Query: 321 CCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLR--GRLNVSGGVSSA 378
           CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+ISAIEDGLR  G  +     SS 
Sbjct: 302 CCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSP 361

Query: 379 LAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQRL 420
           LA K  VVIGAGGAGKALAYGAK KGA+VVIANRTYE    L
Sbjct: 362 LASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALEL 403


>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Length = 219 Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Length = 238 Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Length = 312 Back     alignment and structure
>3js3_A 3-dehydroquinate dehydratase; AROD, covalent reaction intermediate, amino-acid biosynthesis, aromatic amino acid biosynthesis, lyase; HET: DHS; 2.20A {Clostridium difficile} Length = 258 Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Length = 231 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 3nnt_A* 3oex_A 3m7w_A 1gqn_A 1l9w_A* 1qfe_A* Length = 276 Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Length = 259 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Length = 315 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Length = 196 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Length = 287 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* Length = 269 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Length = 283 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Length = 282 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Length = 263 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Length = 272 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Length = 281 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 100.0
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 100.0
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 100.0
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 100.0
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 100.0
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 100.0
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 100.0
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 100.0
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 100.0
3tum_A 269 Shikimate dehydrogenase family protein; rossmann-f 100.0
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 100.0
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 100.0
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 100.0
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 100.0
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 100.0
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 100.0
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 100.0
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 100.0
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 100.0
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 100.0
3u62_A 253 Shikimate dehydrogenase; shikimate pathway, oxidor 100.0
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 100.0
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 100.0
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 100.0
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 100.0
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 100.0
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 99.91
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 99.9
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.51
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.7
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.67
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.6
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.55
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 97.81
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.59
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.5
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 97.42
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.27
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 97.26
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.13
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.12
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.07
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.05
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.92
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.91
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.8
2rir_A 300 Dipicolinate synthase, A chain; structural genomic 96.77
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.72
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 96.66
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.61
1edz_A 320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.56
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.55
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.52
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 96.43
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.37
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 96.34
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 96.28
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.27
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.27
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.27
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 96.26
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.17
3c85_A 183 Putative glutathione-regulated potassium-efflux S 96.14
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.14
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 96.09
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.09
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 96.07
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 96.05
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.0
4dqx_A 277 Probable oxidoreductase protein; structural genomi 95.97
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 95.96
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.96
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 95.93
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 95.93
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 95.91
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.86
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 95.85
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 95.85
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 95.84
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.83
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 95.83
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.81
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 95.81
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 95.8
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.8
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 95.8
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.8
3rih_A 293 Short chain dehydrogenase or reductase; structural 95.78
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 95.72
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.71
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 95.68
3cxt_A 291 Dehydrogenase with different specificities; rossma 95.66
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 95.64
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.63
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 95.63
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.63
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 95.6
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.57
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 95.56
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.55
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 95.5
1xhl_A 297 Short-chain dehydrogenase/reductase family member 95.5
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 95.5
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 95.43
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 95.32
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 95.31
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.31
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 95.3
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 95.3
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 95.28
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 95.26
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.22
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.19
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.16
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 95.15
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.15
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 95.12
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.12
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.09
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 95.07
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.05
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 95.02
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.01
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 94.98
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.98
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 94.97
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 94.97
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 94.97
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.92
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 94.87
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 94.86
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.83
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 94.79
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.78
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 94.75
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 94.74
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 94.74
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 94.74
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 94.73
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.72
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 94.7
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.7
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 94.7
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.69
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.66
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 94.66
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 94.53
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 94.53
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 94.52
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.51
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 94.48
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 94.47
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.44
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 94.41
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 94.3
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.29
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.29
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 94.26
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 94.25
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 94.25
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.24
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 94.22
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 94.11
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 94.11
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 94.08
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 94.05
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 94.01
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.0
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 93.97
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 93.92
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.91
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 93.91
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 93.9
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 93.89
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 93.88
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 93.86
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 93.86
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 93.84
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 93.84
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 93.82
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 93.76
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 93.75
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 93.74
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.73
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 93.72
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 93.72
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.65
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 93.6
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.55
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 93.55
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 93.54
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 93.53
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 93.46
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 93.42
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 93.41
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 93.4
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.39
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 93.29
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 93.22
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 93.21
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 93.18
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 93.17
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 93.17
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 93.17
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 93.17
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 93.15
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 93.14
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 93.11
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 93.08
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 93.07
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.07
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 93.06
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 93.02
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 93.0
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 92.98
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 92.97
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 92.96
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 92.91
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 92.9
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.87
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 92.82
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 92.78
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 92.73
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 92.72
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 92.72
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 92.67
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 92.66
4eye_A 342 Probable oxidoreductase; structural genomics, niai 92.59
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 92.55
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 92.54
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 92.53
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 92.52
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 92.48
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.45
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.44
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 92.41
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 92.38
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 92.37
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 92.34
1yx1_A264 Hypothetical protein PA2260; structural genomics, 92.34
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 92.3
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.29
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 92.25
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.22
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 92.22
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 92.22
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.2
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.18
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 92.11
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 92.11
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 92.09
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 92.08
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 92.03
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.02
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 91.94
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 91.94
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 91.88
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 91.81
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 91.79
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 91.66
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 91.64
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 91.64
2bry_A 497 NEDD9 interacting protein with calponin homology a 91.63
3gms_A 340 Putative NADPH:quinone reductase; structural genom 91.61
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 91.6
3oa3_A288 Aldolase; structural genomics, seattle structural 91.57
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 91.57
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 91.52
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 91.52
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 91.51
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 91.48
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 91.46
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 91.45
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 91.43
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 91.43
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 91.42
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 91.39
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 91.35
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.32
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 91.32
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 91.3
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 91.3
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 91.27
4ezb_A 317 Uncharacterized conserved protein; structural geno 91.25
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 91.22
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 91.2
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 91.19
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 91.17
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 91.13
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 91.07
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 91.03
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 91.0
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 90.92
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 90.92
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 90.9
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 90.89
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 90.88
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 90.86
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 90.81
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 90.77
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 90.74
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 90.71
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 90.7
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 90.68
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 90.65
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 90.64
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 90.59
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 90.58
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.57
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 90.51
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 90.5
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 90.49
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 90.46
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 90.33
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 90.32
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 90.27
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 90.18
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 90.08
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 90.0
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 89.97
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 89.94
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 89.91
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 89.87
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 89.82
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 89.69
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 89.67
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 89.65
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 89.63
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 89.57
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 89.57
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 89.46
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 89.46
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 89.42
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 89.39
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 89.38
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 89.36
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 89.26
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 89.25
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 89.25
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 89.25
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 89.25
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 89.2
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 89.16
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 89.15
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.12
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 89.12
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 89.1
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 89.02
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 88.99
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 88.96
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 88.86
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 88.84
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 88.76
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 88.71
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 88.64
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 88.6
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 88.58
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 88.49
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 88.43
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 88.4
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 88.4
2q02_A272 Putative cytoplasmic protein; structural genomics, 88.39
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 88.34
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 88.34
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 88.31
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 88.3
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 88.22
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 88.19
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 88.18
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 88.15
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 88.15
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 88.14
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 87.99
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 87.9
4f6c_A 427 AUSA reductase domain protein; thioester reductase 87.82
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 87.78
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 87.77
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 87.73
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 87.69
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 87.65
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 87.63
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 87.62
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 87.61
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 87.57
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 87.54
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 87.37
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 87.35
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 87.27
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 87.25
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 87.19
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 87.1
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 86.85
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 86.78
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 86.77
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 86.73
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 86.67
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 86.64
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 86.55
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 86.53
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 86.43
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 86.42
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 86.36
3lmz_A257 Putative sugar isomerase; structural genomics, joi 86.24
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 86.01
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 85.92
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 85.88
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 85.87
3jsk_A 344 Cypbp37 protein; octameric thiazole synthase, bios 85.87
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 85.84
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 85.8
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 85.64
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 85.64
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 85.63
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 85.59
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 85.54
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 85.46
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 85.46
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 85.42
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 85.39
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 85.38
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 85.37
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 85.33
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 85.28
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 85.26
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 85.25
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 85.18
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 85.18
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 85.09
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 85.08
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 85.01
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 84.87
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 84.84
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 84.82
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 84.8
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 84.78
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 84.75
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 84.73
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 84.69
3e49_A311 Uncharacterized protein DUF849 with A TIM barrel; 84.67
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 84.65
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 84.59
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 84.54
2gjc_A 326 Thiazole biosynthetic enzyme, mitochondrial; gluta 84.53
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 84.51
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 84.5
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 84.47
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 84.24
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 84.17
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 83.86
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 83.81
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 83.81
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 83.79
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 83.68
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 83.66
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 83.45
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 83.35
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 83.3
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 83.23
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 83.21
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 83.18
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 83.17
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 83.13
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 83.12
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 82.91
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 82.9
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 82.89
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 82.75
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 82.71
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 82.66
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 82.63
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 82.62
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 82.4
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 82.2
4djd_C446 C/Fe-SP, corrinoid/iron-sulfur protein large subun 82.19
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 82.16
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 82.1
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 82.06
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 82.03
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 82.01
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 81.89
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 81.86
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 81.83
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 81.73
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 81.63
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 81.63
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 81.6
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 81.57
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 81.56
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 81.56
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 81.54
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 81.52
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 81.48
1lnq_A 336 MTHK channels, potassium channel related protein; 81.47
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 81.46
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 81.36
2zvr_A290 Uncharacterized protein TM_0416; hyperthermophIle, 81.33
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 81.32
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 81.29
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 81.29
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 81.25
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-97  Score=781.10  Aligned_cols=399  Identities=76%  Similarity=1.180  Sum_probs=361.1

Q ss_pred             CCCcEEEEeecCCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCCCCCCCCCCHHHH
Q 014691           21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENER  100 (420)
Q Consensus        21 ~~~~~icv~l~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~  100 (420)
                      +++|+|||||+++|++|++.+++++...|+|+||||+|+|.+.++.++++.+++..++|+|||+|+++|||.++.++++|
T Consensus         2 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRvD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~   81 (523)
T 2o7s_A            2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENER   81 (523)
T ss_dssp             CSCCEEEEEECCSSHHHHHHHHHHHHHHTCSEEEEEGGGCSSCCHHHHHHHHHHHCSSCEEEECCBGGGTSSBCSCHHHH
T ss_pred             CCCCEEEEEecCCCHHHHHHHHHHhhhcCCCEEEEEEecccccChHHHHHHHHhcCCCcEEEEecccccCCCCCCCHHHH
Confidence            57899999999999999999999888889999999999998776666888888888999999999999999999999999


Q ss_pred             HHHHHHHHHhCCcEEEEEcccccchhHHHhhcCCCCcEEEEEcccCCCCCCHHHHHHHHHHHHHcCCCEEEEEeecCCHH
Q 014691          101 VDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDIT  180 (420)
Q Consensus       101 ~~ll~~~~~~~~d~iDiEl~~~~~~~~~l~~~~~~~~kiI~S~H~f~~tP~~~el~~~~~~~~~~gaDivKia~~~~s~~  180 (420)
                      +++|+.++++|+||||||++.+++.++.+...+..++|||+|||||++||+++++.++|++|.++||||+|||+||++.+
T Consensus        82 ~~ll~~~~~~~~~yiDvEl~~~~~~~~~~~~~~~~~~kiI~S~H~f~~tp~~~~~~~~~~~~~~~gaDivKia~~a~~~~  161 (523)
T 2o7s_A           82 RDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIA  161 (523)
T ss_dssp             HHHHHHHHHHTCSEEEEEHHHHHHHHHHTTTCCCTTCEEEEEEECSSCCCCHHHHHHHHHHHHTTTCSEEEEEEECSSGG
T ss_pred             HHHHHHHHHhCCCEEEEECCCchHHHHHHHHhccCCCEEEEEcccCCCCcCHHHHHHHHHHHHHhCCCEEEEEecCCCHH
Confidence            99999999999999999999998888877665556899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccCCCCEEEEecCCcchhhhhhccccCCcccccccCCCccCCCCCCCHHhHHHHHhccccCCCceEEeeec
Q 014691          181 DVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG  260 (420)
Q Consensus       181 D~~~ll~~~~~~~~p~I~~~MG~~G~~SRi~~~~~Gs~ltf~~~~~~~~sAPGQ~~~~~l~~~~~~~~~~~~~~~~~v~G  260 (420)
                      |++++++++.+.+.|+|+||||+.|++||+++++|||++||++++.++++||||+++++++++|++.+++++|++|||+|
T Consensus       162 D~~~l~~~~~~~~~p~i~~~MG~~G~~SRil~~~~gs~lt~~~l~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~viG  241 (523)
T 2o7s_A          162 DVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG  241 (523)
T ss_dssp             GHHHHHHHHHHCSSCEEEEEESGGGTHHHHCTTTTTCSEEECBSSTTCCSSTTCCBHHHHHHTSCGGGCCTTCEEEEEEE
T ss_pred             HHHHHHHHHhhcCCCEEEEEcCCCCchhhhhhhhcCCceeecCCCccccCCCCCCcHHHHHHHHhhhhccccceEEEEEC
Confidence            99999999888889999999999999999999999999999999865558999999999999999999999999999999


Q ss_pred             cCccccccHHHHHHHHHHcCCCceeeccccccHHHHHHHhcCCCCCEEEEcccchHHHHhhhhcccHHHHHhcceeEEEE
Q 014691          261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIR  340 (420)
Q Consensus       261 ~pv~hS~SP~ihn~~f~~~gl~~~y~~~~~~~l~~~~~~~~~~~~~G~~VT~P~K~~i~~~~d~l~~~A~~iGAvNTi~~  340 (420)
                      +||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||++|++|+|++++.|+.+||||||++
T Consensus       242 ~pi~hS~SP~~hn~~f~~~gl~~~Y~~~~~~~l~~~~~~~~~~~~~G~nVTiP~K~~i~~~ld~~~~~A~~iGAvNti~~  321 (523)
T 2o7s_A          242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILR  321 (523)
T ss_dssp             SSCTTCCHHHHHHHHHHHTTCSEEEEEEECSCHHHHHHHTCSTTEEEEEECTTCHHHHHHHCSEECHHHHHHTCCSEEEE
T ss_pred             CCccCCccHHHHHHHHHHcCCCcEEEeEEcchHHHHHHHHhcCCCCEEEECCCCHHHHHHHhcccCHHHHHhCCCeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             eccCCeEEEEecCHHHHHHHHHhhhccCCCCCC--CcccccCCCEEEEEccchHHHHHHHHHHhCCCeEEEEeCChhhhh
Q 014691          341 RQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSG--GVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYENLQ  418 (420)
Q Consensus       341 ~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~--~~~~~~~~k~vlviGaGGaara~~~aL~~~g~~i~v~nR~~~ka~  418 (420)
                      +..+|+|+||||||.||+.+|+..+....+...  .....+++|+++|+||||+|++++++|.+.|++|+++||+.++++
T Consensus       322 ~~~~gk~~g~nTD~~G~~~~l~~~~~~~~~~~~~~~~~~~l~~k~vlV~GaGGig~aia~~L~~~G~~V~i~~R~~~~a~  401 (523)
T 2o7s_A          322 RKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERAL  401 (523)
T ss_dssp             CTTTCCEEEECCHHHHHHHHHHHHC-------------------CEEEECCSHHHHHHHHHHHHHCC-CEEEESSHHHHH
T ss_pred             ecCCCeEEEEcCCHHHHHHHHHHhhhhccccccccccccccCCCEEEEECCcHHHHHHHHHHHHCCCEEEEEECCHHHHH
Confidence            622799999999999999999876421000000  001246789999999999999999999999999999999999887


Q ss_pred             c
Q 014691          419 R  419 (420)
Q Consensus       419 ~  419 (420)
                      +
T Consensus       402 ~  402 (523)
T 2o7s_A          402 E  402 (523)
T ss_dssp             H
T ss_pred             H
Confidence            5



>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3e49_A Uncharacterized protein DUF849 with A TIM barrel; structural genomics, joint center for structural genomics; HET: MSE; 1.75A {Burkholderia xenovorans LB400} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4djd_C C/Fe-SP, corrinoid/iron-sulfur protein large subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_C* 4djf_C* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d1gqna_252 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 8e-73
d1sfla_236 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 1e-71
d1p77a2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 2e-28
d1vi2a2102 c.58.1.5 (A:5-106) Putative shikimate dehydrogenas 3e-28
d1nyta2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 3e-27
d1nvta2110 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE 3e-26
d1npya2102 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like 1e-25
d1jaya_ 212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 2e-04
d1pr9a_ 244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 4e-04
d1yb1a_ 244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 4e-04
d1k2wa_ 256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 6e-04
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 6e-04
d1nffa_ 244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 6e-04
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 7e-04
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 7e-04
d1p77a1 171 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE 8e-04
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 0.001
d1cyda_ 242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.001
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 0.001
d1fmca_ 255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 0.001
d1hdca_ 254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 0.001
d1o5ia_ 234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.001
d1ydea1 250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.001
d1xg5a_ 257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 0.002
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 0.002
d1vl8a_ 251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.002
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 0.002
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.002
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 0.002
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 0.002
d2ag5a1 245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 0.002
d2a4ka1 241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 0.002
d1q7ba_ 243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.002
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 0.002
d1zk4a1 251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 0.002
d2o23a1 248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 0.002
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 0.002
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.003
d1oaaa_ 259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 0.003
d1e5qa1 182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 0.003
d1ulsa_ 242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.003
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 0.003
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.004
d1qsga_ 258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 0.004
d2h7ma1 268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 0.004
d1npya1 167 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like 0.004
d1uzma1 237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 0.004
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
 Score =  226 bits (578), Expect = 8e-73
 Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 14/234 (5%)

Query: 24  TLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKE-----SPV 78
             I V +MG  ++ +  +      +  D++E R+D   +    +++ T  +        +
Sbjct: 16  PKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDI 75

Query: 79  PTLFTYRPIWEGGQYDGDENERVDVLRLAMELG-ADYIDVELQVA-REFNDSIRGKKPEK 136
           P LFT+R   EGG+        + + R A++ G  D ID+EL     +   ++       
Sbjct: 76  PLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHN 135

Query: 137 CKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVH----- 191
             V++S+H++  TPS E++ + + ++QA GADI K A       DV  +   T+      
Sbjct: 136 VYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY 195

Query: 192 SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYN 245
           +  P+I + M + G+ISR+    FG   TFG ++    SAPGQ  + DL  +  
Sbjct: 196 ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDLRSVLM 247


>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Length = 236 Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 101 Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 110 Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 102 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 171 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 167 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 100.0
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 100.0
d1p77a2101 Shikimate 5-dehydrogenase AroE {Haemophilus influe 100.0
d1vi2a2102 Putative shikimate dehydrogenase YdiB {Escherichia 100.0
d1nyta2101 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 100.0
d1nvta2110 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 99.97
d1npya2102 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 99.97
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 99.29
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 99.16
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 99.11
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.57
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.22
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.41
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.93
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.87
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.66
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.6
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.25
d1piwa2 168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.25
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.22
d1e3ja2 170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.12
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.1
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.09
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.07
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.93
d1pl8a2 171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.8
d1d1ta2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.72
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.71
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.64
d1jqba2 174 Bacterial secondary alcohol dehydrogenase {Clostri 95.63
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.57
d1p0fa2 174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.53
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.5
d1e3ia2 174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.48
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 95.46
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.33
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.24
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.23
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.17
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.13
d2jhfa2 176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.05
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.02
d1rjwa2 168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.01
d1l7da1 183 Nicotinamide nucleotide transhydrogenase dI compon 94.97
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.87
d1v8ba1 163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.82
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.76
d1f8fa2 174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.69
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.61
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.55
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.53
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.5
d1yb5a2 174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.43
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.41
d2fzwa2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.36
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.34
d1cdoa2 175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.26
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 94.08
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.98
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.96
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 93.95
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 93.94
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.89
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 93.87
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapien 93.83
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.71
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.68
d1iz0a2 171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.67
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.44
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.3
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 92.85
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.83
d1jvba2 170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.78
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 92.64
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 92.61
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 92.49
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.44
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 92.35
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 92.3
d1v3va2 182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.13
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.03
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 91.94
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.9
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 91.74
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 91.7
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 91.6
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 91.51
d1ygya1 184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.47
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 91.4
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 91.24
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.06
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.05
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.0
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.86
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 90.77
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 90.69
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 90.67
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 90.67
d1o89a2 177 Hypothetical protein YhdH {Escherichia coli [TaxId 90.53
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 89.97
d1tt7a2 167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 89.89
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 89.53
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.3
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.05
d1edza1 171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.97
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 88.66
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 88.34
d1xa0a2 176 B. subtilis YhfP homologue {Bacillus stearothermop 88.18
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 88.12
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.04
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 87.79
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 87.56
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.43
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.21
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 86.75
d1vj1a2 187 Putative zinc-binding alcohol dehydrogenase {Mouse 86.42
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 86.04
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 85.03
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 85.0
d1omoa_ 320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 84.83
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 84.76
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 84.61
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.59
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 84.22
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 84.15
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 83.98
d1x7da_ 340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 83.74
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 83.64
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 83.48
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 82.98
d2g0wa1275 Hypothetical protein Lmo2234 {Listeria monocytogen 82.79
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 82.72
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 82.25
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 81.81
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 81.62
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 81.51
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 80.25
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 80.21
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 80.15
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 80.13
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
Probab=100.00  E-value=9.7e-58  Score=435.45  Aligned_cols=232  Identities=26%  Similarity=0.420  Sum_probs=207.7

Q ss_pred             ccccCCCCCCcEEEEeecCCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHH----HHHhhC-CCcEEEEeccCC
Q 014691           14 LVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIK----TLIKES-PVPTLFTYRPIW   88 (420)
Q Consensus        14 ~~~~~~~~~~~~icv~l~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~----~l~~~~-~~PiI~T~R~~~   88 (420)
                      +..-.++..+|+|||||++++.++++++++++...+||+||||+|+|.+..+.+.+.    .+++.. ++|+|||+|+++
T Consensus         6 v~~~~~g~g~pkIcv~l~~~~~~~~~~~~~~~~~~~aD~vE~RlD~l~~~~~~~~l~~~~~~lr~~~~~~PiI~T~R~~~   85 (252)
T d1gqna_           6 VKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAK   85 (252)
T ss_dssp             ETTEEETSSSCEEEEEECCSSHHHHHHHHHHHTTSCCSEEEEEGGGCSCTTCHHHHHHHHHHHHHHCTTSCEEEECCBGG
T ss_pred             ECCEEecCCCCEEEEEeCCCCHHHHHHHHHHHhhcCCCEEEEEEccccccCCHHHHHHHHHHHHHhcCCCCEEEEEechh
Confidence            344456678999999999999999999999998889999999999998765544443    333333 699999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhC-CcEEEEEcccccchhHHHhh-cCCCCcEEEEEcccCCCCCCHHHHHHHHHHHHHcC
Q 014691           89 EGGQYDGDENERVDVLRLAMELG-ADYIDVELQVAREFNDSIRG-KKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASG  166 (420)
Q Consensus        89 eGG~~~~~~~~~~~ll~~~~~~~-~d~iDiEl~~~~~~~~~l~~-~~~~~~kiI~S~H~f~~tP~~~el~~~~~~~~~~g  166 (420)
                      |||.|++++++|+++|+.++++| |||||||++..++.+..+.. .+..++++|+|||||++||+.+++.+++++|.++|
T Consensus        86 eGG~~~~~~~~~~~ll~~~~~~~~~d~iDiEl~~~~~~~~~li~~a~~~~~~vI~S~Hdf~~TP~~~~l~~~~~~m~~~g  165 (252)
T d1gqna_          86 EGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALG  165 (252)
T ss_dssp             GTCSBCCCHHHHHHHHHHHHHHSCCSEEEEEGGGCHHHHHHHHHHHHHTTCEEEEEEEESSCCCCHHHHHHHHHHHHHTT
T ss_pred             hCCCCCCCHHHHHHHHHHHHHcCCCceEeccccccHHHHHHHHHHhhcCCCeEEEEecCCCCCCCHHHHHHHHHHHHHhC
Confidence            99999999999999999999999 89999999998887776663 45689999999999999999999999999999999


Q ss_pred             CCEEEEEeecCCHHHHHHHHHHhcc-----CCCCEEEEecCCcchhhhhhccccCCcccccccCCCccCCCCCCCHHhHH
Q 014691          167 ADIVKFATTALDITDVARVFQITVH-----SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLL  241 (420)
Q Consensus       167 aDivKia~~~~s~~D~~~ll~~~~~-----~~~p~I~~~MG~~G~~SRi~~~~~Gs~ltf~~~~~~~~sAPGQ~~~~~l~  241 (420)
                      |||+|+|+||++.+|++++++++.+     .++|+|+|+||+.|++||+++++|||++||++++++  +||||+++++|+
T Consensus       166 aDivKia~~a~~~~D~~~ll~~~~~~~~~~~~~P~I~~~MG~~G~~SRi~~~~~GS~~tya~~~~~--sAPGQ~~~~~l~  243 (252)
T d1gqna_         166 ADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDLR  243 (252)
T ss_dssp             CSEEEEEECCSSHHHHHHHHHHHHHHHHHTCSSCCEEEECTTTTHHHHHCHHHHTCCEEECBSSSC--CSTTCCBHHHHH
T ss_pred             CCeEEEEecCCCHHHHHHHHHHHHHHHHhCCCCCEEEEecCCcchhHHHHHHHhCCceEeccCCCC--CCCCCCCHHHHH
Confidence            9999999999999999999988643     378999999999999999999999999999999865  999999999999


Q ss_pred             HHHhcc
Q 014691          242 DLYNFR  247 (420)
Q Consensus       242 ~~~~~~  247 (420)
                      ++++..
T Consensus       244 ~~l~~l  249 (252)
T d1gqna_         244 SVLMIL  249 (252)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            999864



>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure