Citrus Sinensis ID: 014696


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MKFLSIVGNSFGCSASGERLVSAARDGDLQEAKALLEYNPRLVRYSTFGVRNSPLHYSAAQGHHEIVSLLIESGVDINLRNYRGQTALMQACQHGHWEVVLTLILYKANIHRADYLNGGTALHLAALNGHSRCIRLLLADYIPSVPNAWNRLRKKSNKTGSILEFDERYFHLEVLLHLTLNGHVESVQLLLDLGASVSEYLSVSGAGSTSLHYAACGGNAQCCQILIAMGASLTAENANGWTPLMVARSWHRTGLEDILSTQPEGRLEVLPSPYLALPLMSIVKIARECGWRNSDSLSTCPDPCVVCLERKCTVAAKGCDHEFCTQCALYLCSTNSSCVVAKGPIGSIPCPLCRHGIVSFDKLPGTRPIKEITRTSSLSLTFCTCSVDHQVQESTSLTTGLCKPGFHCTRISPLDLLSVA
ccHHHHHccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHcccccccccHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccccHHHHcccccccccccccccccccccccccccccccccccc
MKFLSIVGNSFGCSASGERLVSAARDGDLQEAKALLEYNPRLVRYSTFGVRNSPLHYSAAQGHHEIVSLLIESGVDINLRNYRGQTALMQACQHGHWEVVLTLILYKANIHRADYLNGGTALHLAALNGHSRCIRLLLADYIPSVPNAWNRLRKKSNKTGSILEFDERYFHLEVLLHLTLNGHVESVQLLLDLGASVSEYLSVSGAGSTSLHYAACGGNAQCCQILIAMGASLTAENANGWTPLMVARSWHRTGLEDILSTQPEGRLEVLPSPYLALPLMSIVKIARECGWRNSDSLSTCPDPCVVCLERKCTVAAKGCDHEFCTQCALYLCSTNSSCVVAKGPIGSIPCPLCRHGIVSFDKLPGTRPIKEITRTSSLSLTFCTCS***************CKPGFHCTRISPLDLLSVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFLSIVGNSFGCSASGERLVSAARDGDLQEAKALLEYNPRLVRYSTFGVRNSPLHYSAAQGHHEIVSLLIESGVDINLRNYRGQTALMQACQHGHWEVVLTLILYKANIHRADYLNGGTALHLAALNGHSRCIRLLLADYIPSVPNAWNRLRKKSNKTGSILEFDERYFHLEVLLHLTLNGHVESVQLLLDLGASVSEYLSVSGAGSTSLHYAACGGNAQCCQILIAMGASLTAENANGWTPLMVARSWHRTGLEDILSTQPEGRLEVLPSPYLALPLMSIVKIARECGWRNSDSLSTCPDPCVVCLERKCTVAAKGCDHEFCTQCALYLCSTNSSCVVAKGPIGSIPCPLCRHGIVSFDKLPGTRPIKEITRTSSLSLTFCTCSVDHQVQESTSLTTGLCKPGFHCTRISPLDLLSVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable E3 ubiquitin-protein ligase XBOS32 probableQ6KAE5
E3 ubiquitin-protein ligase XBAT32 E3 ubiquitin-protein ligase that mediates ubiquitination of ACC synthases (ACS). Negatively regulates ethylene biosynthesis probably via ubiquitin-dependent degradation of ACS4 and ACS7 enzymes. Regulates lateral root formation and development by controlling ethylene production which inhibits lateral root formation at high concentration.probableQ6NLQ8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 17-282
View the alignment between query and template
View the model in PyMOL
Template: 2AJA, chain A
Confidence level:very confident
Coverage over the Query: 16-142,171-275
View the alignment between query and template
View the model in PyMOL
Template: 4G8K, chain A
Confidence level:very confident
Coverage over the Query: 16-148,160-331
View the alignment between query and template
View the model in PyMOL
Template: 2Y1N, chain A
Confidence level:confident
Coverage over the Query: 302-334,346-363
View the alignment between query and template
View the model in PyMOL