Citrus Sinensis ID: 014706

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420

MMSMTSHNLDFGRSVLDLVACGCSSSASIHRSSVRKIAMTGSRKSNRDCGARRLVCCRQNLARCRVYSTKTPETLLNVGQIPPAVLNLKEKSRSPISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRATAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETVHQLYGTRVAVLAGDFMFAQSSWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDLELEEYLIKSYYKTASLIAASTKGAAIFSGVDGSLSKQMYEYGRNLGLSFQIVDDILDFTQSAEQLGKPAASDLAKGNLTAPVIFALEKEPKLREIIESEFCETGSLDEAIKLVKTSGGIEEAQELAKEKANLAIHNLHCLPRSPFRVALEDMVMFNLERFV

ccccccccccccccHHHcccccccccccccccHHHHHHHcccccccccccccccccccccccEEECcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHHcccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc

*********DFGRSVLDLVACGCS************************CGARRLVCCRQNLARCRVYSTKTPETLLNVGQIPPAVLNLKEKSRSPISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRATAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETVHQLYGTRVAVLAGDFMFAQSSWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDLELEEYLIKSYYKTASLIAASTKGAAIFSGVDGSLSKQMYEYGRNLGLSFQIVDDILDFTQSAEQLGKPAASDLAKGNLTAPVIFALEKEPKLREIIESEFCETGSLDEAIKLVKTSGGIEEAQELAKEKANLAIHNLHCLPRSPFRVALEDMVMFNLERFV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Solanesyl diphosphate synthase 2, chloroplastic	Involved in providing solanesyl diphosphate for plastoquinone-9 formation. Prefers geranylgeranyl diphosphate to farnesyl diphosphate as substrate. No activity with geranyl diphosphate or dimethylallyl diphosphate as substrate.	confident	Q76FS5
Solanesyl-diphosphate synthase 2, chloroplastic	Involved in providing solanesyl diphosphate for plastoquinone-9 formation. Geranyl diphosphate is the preferred substrate.	probable	Q75HZ9
Decaprenyl-diphosphate synthase subunit 1	Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.	probable	Q33DR2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APZ, chain A
Confidence level:very confident
Coverage over the Query: 102-125,138-187,204-420
View the alignment between query and template
View the model in PyMOL