Citrus Sinensis ID: 014769

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42

MENGAENKWGFEDKQEHKAAPAVTVKTSLASIIDSVNKNDPRPVVPLGYGDPTAFPCFRTAVEAEDAIVDAVRSGKFNCYATNSGIPPARRAIADYLSRDLPYKLSADDVYVTLGCKQAVEVILSVLARPGANVLLPRPGWPYYEGIAQRKQVEVRHFDLLPERNWEVDLDAVEALADKNTAAMVIINPGNPCGNVFTYHHLQEIAEMARKLRVMVVADEVYGHLTFGSIPYTPMGLFGSIVPVITLGSISKRWLVPGWRFGWLVTNDPNGIFQKSGIIDSIKDCLSIYSDIPTFIQGAIPQILEKTKEDFFCKLIDTLRESAEICYDGVKEIPCISCPNKPEGSMVTMVKLNPWLLEDINDDIEFALKLAKEESVIVTPGIYVGLKNWLRIAFCAEPSALKDGLGRMKAFCQRHTKKH

cccccccccccccHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccEEEcccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHcccEEEEEEccccccccccHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccEEEEcccccccccccccccHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEECcccccccccccHHHHHHHHHHHccEEEEccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcc

************************V*TSLASIIDSVN***PRPVVPLGYGDPTAFPCFRTAVEAEDAIVDAVRSGKFNCYATNSGIPPARRAIADYLSRDLPYKLSADDVYVTLGCKQAVEVILSVLARPGANVLLPRPGWPYYEGIAQRKQVEVRHFDLLPERNWEVDLDAVEALADKNTAAMVIINPGNPCGNVFTYHHLQEIAEMARKLRVMVVADEVYGHLTFGSIPYTPMGLFGSIVPVITLGSISKRWLVPGWRFGWLVTNDPNGIFQKSGIIDSIKDCLSIYSDIPTFIQGAIPQILEKTKEDFFCKLIDTLRESAEICYDGVKEIPCISCPNKPEGSMVTMVKLNPWLLEDINDDIEFALKLAKEESVIVTPGIYVGLKNWLRIAFCAEPSALKDGLGRMKAFCQRH****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable aminotransferase TAT2		probable	Q9FN30
Tyrosine aminotransferase	Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has no transaminase activity towards phenylalanine.	probable	P17735
Tyrosine aminotransferase	Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has no transaminase activity towards phenylalanine.	probable	P04694

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DYD, chain A
Confidence level:very confident
Coverage over the Query: 9-16,33-417
View the alignment between query and template
View the model in PyMOL