Citrus Sinensis ID: 014802


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MSGQTRKKIQKKMKIRGYGLRMDALDEILSFVNRFPDAEDEAIDLLLDQFEHESSLKSSIIDKESVNRVTSVLLQAEAAAEGDSGSASNHSAIRVIDAFLVPKFRYDSIKKHFYQHAGSLPIHGEASAKAALYRDRFLLLFQRVSRDQHFSRPSFDVVNSEFGSCEISTIQSLVGQTGRRWVMGVISQLEDGHFYLEDLAASVEIDLSKAKITTGFFTENTIVVAEGEMLVDGIFQVITCGFPPLEDRDQSLKLLAGYDFFGGGTLKKEDTLRLADLEKRAANDMFVILSDIWLDNEEVMGKLEVVLDGFESVEVVPSLFVFMGNFCSHPCNLSFHSFSSLRLQFGKLGQMIAAHPRLKEHSRFLFIPGPDDAGPSTVLPRCALPKYLTEELQKYIPNAIFSSNPCRLNFLITVQLNH
ccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccccccEEEEEEEEEcccccEEEEccccEEEEEcccccccccEECccEEEEEEEEEEEccEEEEEECcccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccCEEEEEccccccccccccccccccHHHHHHHHHHccccEEECcccEEcccccccccc
*****RK*IQKKMKIRGYGLRMDALDEILSFVNRFPDAEDEAIDLLLDQF*********************V***************SNHSAIRVIDAFLVPKFRYDSIKKHFYQHAGSLPIHGEASAKAALYRDRFLLLFQRVSRDQHFSRPSFDVVNSEFGSCEISTIQSLVGQTGRRWVMGVISQLEDGHFYLEDLAASVEIDLSKAKITTGFFTENTIVVAEGEMLVDGIFQVITCGFPPLEDRDQSLKLLAGYDFFGGGTLKKEDTLRLADLEKRAANDMFVILSDIWLDNEEVMGKLEVVLDGFESVEVVPSLFVFMGNFCSHPCNLSFHSFSSLRLQFGKLGQMIAAHPRLKEHSRFLFIPGPDDAGPSTVLPRCALPKYLTEELQKYIPNAIFSSNPCRLNFLITVQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGQTRKKIQKKMKIRGYGLRMDALDEILSFVNRFPDAEDEAIDLLLDQFEHESSLKSSIIDKESVNRVTSVLLQAEAAAEGDSGSASNHSAIRVIDAFLVPKFRYDSIKKHFYQHAGSLPIHGEASAKAALYRDRFLLLFQRVSRDQHFSRPSFDVVNSEFGSCEISTIQSLVGQTGRRWVMGVISQLEDGHFYLEDLAASVEIDLSKAKITTGFFTENTIVVAEGEMLVDGIFQVITCGFPPLEDRDQSLKLLAGYDFFGGGTLKKEDTLRLADLEKRAANDMFVILSDIWLDNEEVMGKLEVVLDGFESVEVVPSLFVFMGNFCSHPCNLSFHSFSSLRLQFGKLGQMIAAHPRLKEHSRFLFIPGPDDAGPSTVLPRCALPKYLTEELQKYIPNAIFSSNPCRLNFLITVQLNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FLO, chain A
Confidence level:confident
Coverage over the Query: 125-156,169-251,267-413
View the alignment between query and template
View the model in PyMOL
Template: 2V6Z, chain M
Confidence level:confident
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL
Template: 3E0J, chain A
Confidence level:confident
Coverage over the Query: 104-115,133-253,279-413
View the alignment between query and template
View the model in PyMOL