Citrus Sinensis ID: 014817

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MPGSLEPLDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTYGSRLSALRRLRGLARDSDKNRSLISSHNVRAILSQVFFTNINVKTASSPELAHESLALLVMFPLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCDAERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQRDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccc
**********SVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLL***************ALRRLRGLARDSDKNRSLISSHNVRAILSQVFFTNINVKTASSPELAHESLALLVMFPLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCDAERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQRDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWP***********CSEVVPF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGSLEPLDLSVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSFGVQRIPTPKQPAEPSLVRTLLNQASSESNTYGSRLSALRRLRGLARDSDKNRSLISSHNVRAILSQVFFTNINVKTASSPELAHESLALLVMFPLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCDAERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQRDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U-box domain-containing protein 26 Functions as an E3 ubiquitin ligase.probableQ9FXA4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z6H, chain A
Confidence level:very confident
Coverage over the Query: 101-398
View the alignment between query and template
View the model in PyMOL
Template: 2C2L, chain A
Confidence level:very confident
Coverage over the Query: 10-85
View the alignment between query and template
View the model in PyMOL