Citrus Sinensis ID: 014860


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MMIIAGRNWLRQIFSHRTFNKHLCCTNSSHNSKTLSNYYLSQTQINPHLKLSSNAILCSCYSAIALSRSSSRGVGKRSKADSKPALDDTQFRCAVSELPPRFNNEELCNVMTLQEDPLVCLELFNWASKQPRFRHDASTYHIMTRKLGAAKMYQEMDDVVNQMLATPSFCGTEALYNTIIYFFAEARKLSRAVYVFKYMKNSRNLECRPSIRSYNILFTAFLSRGKNTYINHVYMETIRCLFKQMVNDGIEPDIFSLNSMIKGYILSNHVNDALRIFHQMGVVYNYLPNSFSYDYLIHGLCAQGRTKNARELCDEMKRKGFVPSSKSYNSLVSALALNGEVEETVKNLWEMIEKQRPVDFITYRTVLDEICRRGRAGEAMKLLKELQNKNLIDGYTYTKLLDVLEDDFGNSIRHHLR
cEEEcccccHHHHHHHHHcccccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccHHHHHcccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHcccc
**IIAGRNWLRQIFSHRTFNKHLCCTNSSHNSKTLSNYYLSQTQINPHLKLSSNAILCSCYSAIALSRSSSRGVGKRSKADSKPAL**TQFRCAVSELPPRFNNEELCNVMTLQEDPLVCLELFNWASKQPRFRHDASTYHIMTRKLGAAKMYQEMDDVVNQMLATPSFCGTEALYNTIIYFFAEARKLSRAVYVFKYMKNSRNLECRPSIRSYNILFTAFLSRGKNTYINHVYMETIRCLFKQMVNDGIEPDIFSLNSMIKGYILSNHVNDALRIFHQMGVVYNYLPNSFSYDYLIHGLCAQGRTKNARELCDEMKRKGFVPSSKSYNSLVSALALNGEVEETVKNLWEMIEKQRPVDFITYRTVLDEICRRGRAGEAMKLLKELQNKNLIDGYTYTKLLDVLEDDFGN**RHHLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMIIAGRNWLRQIFSHRTFNKHLCCTNSSHNSKTLSNYYLSQTQINPHLKLSSNAILCSCYSAIALSRSSSRGVGKRSKADSKPALDDTQFRCAVSELPPRFNNEELCNVMTLQEDPLVCLELFNWASKQPRFRHDASTYHIMTRKLGAAKMYQEMDDVVNQMLATPSFCGTEALYNTIIYFFAEARKLSRAVYVFKYMKNSRNLECRPSIRSYNILFTAFLSRGKNTYINHVYMETIRCLFKQMVNDGIEPDIFSLNSMIKGYILSNHVNDALRIFHQMGVVYNYLPNSFSYDYLIHGLCAQGRTKNARELCDEMKRKGFVPSSKSYNSLVSALALNGEVEETVKNLWEMIEKQRPVDFITYRTVLDEICRRGRAGEAMKLLKELQNKNLIDGYTYTKLLDVLEDDFGNSIRHHLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pentatricopeptide repeat-containing protein At2g27800, mitochondrial probableQ9ZUY1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SPA, chain A
Confidence level:very confident
Coverage over the Query: 172-339
View the alignment between query and template
View the model in PyMOL
Template: 3SPA, chain A
Confidence level:very confident
Coverage over the Query: 251-378
View the alignment between query and template
View the model in PyMOL
Template: 4G26, chain A
Confidence level:confident
Coverage over the Query: 171-373
View the alignment between query and template
View the model in PyMOL
Template: 4G26, chain A
Confidence level:confident
Coverage over the Query: 210-407
View the alignment between query and template
View the model in PyMOL
Template: 3IEG, chain A
Confidence level:confident
Coverage over the Query: 88-405
View the alignment between query and template
View the model in PyMOL