Citrus Sinensis ID: 014870

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------

MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGGLVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTILAVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRPVSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIKDGAEGPRGWMNSGLPWIPPKKALGLDLSNLTETISGAIGEGSEGFSVTLAIAAAAGLGVLAFSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKELADDIKQIGKTLLPSPANGKALPASTDSKVQKADDSPEAVPQPKVEAAADPPPQYPDLKPPTSPTPSQP

ccccccccccccHHcccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccEEEEccccHHHHHcccccccccccccEEEEcccccccHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHcccccEEEcccccccccHHHHccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

********LIPLSVL********************************NFLECFAKSVHGGLVLLSSVLGTGLAQALTYEEA************DASGFIDSVISFGTENPLAIAGGVTILAVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRPVSIVYKGDDKPGFLKKLSLKFKEPENTTLFILDKFDGNSELVAELVTINGFKNAYTIKDGAEGPRGWMNSGLPWIPPKKALGLDLSNLTETISGAIGEGSEGFSVTLAIAAAAGLGVLAFSEIETILQILGSAALVQFASKKLLFAEDRKQTLQQVDEFLNTKVAPKE*********************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rhodanese-like domain-containing protein 4, chloroplastic	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	probable	Q9M158

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VEE, chain A
Confidence level:very confident
Coverage over the Query: 136-263
View the alignment between query and template
View the model in PyMOL

Template: 4F67, chain A
Confidence level:confident
Coverage over the Query: 49-268
View the alignment between query and template
View the model in PyMOL

Template: 3MHP, chain C
Confidence level:probable
Coverage over the Query: 398-417
View the alignment between query and template
View the model in PyMOL

Template: 2PFF, chain A
Confidence level:probable
Coverage over the Query: 113-417
View the alignment between query and template
View the model in PyMOL