Citrus Sinensis ID: 014873
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 417 | ||||||
| 225445438 | 441 | PREDICTED: nudix hydrolase 19, chloropla | 0.966 | 0.913 | 0.749 | 0.0 | |
| 255566955 | 400 | mutt/nudix hydrolase, putative [Ricinus | 0.916 | 0.955 | 0.763 | 1e-179 | |
| 15241252 | 438 | nudix hydrolase 19 [Arabidopsis thaliana | 0.961 | 0.915 | 0.706 | 1e-177 | |
| 297808073 | 438 | hypothetical protein ARALYDRAFT_488907 [ | 0.961 | 0.915 | 0.708 | 1e-176 | |
| 224122522 | 414 | predicted protein [Populus trichocarpa] | 0.911 | 0.917 | 0.744 | 1e-175 | |
| 449443109 | 441 | PREDICTED: nudix hydrolase 19, chloropla | 0.923 | 0.873 | 0.730 | 1e-173 | |
| 224088057 | 395 | predicted protein [Populus trichocarpa] | 0.913 | 0.964 | 0.714 | 1e-170 | |
| 356514398 | 426 | PREDICTED: nudix hydrolase 19, chloropla | 0.949 | 0.929 | 0.704 | 1e-167 | |
| 255636719 | 526 | unknown [Glycine max] | 0.959 | 0.760 | 0.628 | 1e-152 | |
| 356513933 | 524 | PREDICTED: LOW QUALITY PROTEIN: nudix hy | 0.959 | 0.763 | 0.624 | 1e-151 |
| >gi|225445438|ref|XP_002285069.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 650 bits (1678), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 314/419 (74%), Positives = 349/419 (83%), Gaps = 16/419 (3%)
Query: 1 MSTNLQTQAFAGNPIRSKTPKSTDPFSPTSALESLKTRLLDNTLHCQPQKHHSSLSSSSS 60
MSTNL+T AFAGNP+RS TPK FSP SA E+LK+RLL+N L
Sbjct: 37 MSTNLKTHAFAGNPLRSTTPKPESLFSPISAFETLKSRLLENAL--------------LP 82
Query: 61 SSPDFKVLPFRKGRPLTYSG--PGETAPVWHLGWISLGDCKIFLANSGIELKEEALVYLG 118
SSP FKVLPFRKGRPL S G++ P+WHLGW +LGD K FLANS + E + VYLG
Sbjct: 83 SSPIFKVLPFRKGRPLAISTRPTGDSPPIWHLGWFNLGDFKGFLANSEFQPTENSFVYLG 142
Query: 119 SRSADDVVYWAIDVSDGDSLASEFGSKQLCFVELRTVMVATDWADQRAMADLAIAGHARA 178
SRS DDVVYW IDVS+ SL +FG+K FVELRT+MVATDW D+RAM+DLAIAGHARA
Sbjct: 143 SRSEDDVVYWGIDVSEDSSLVPQFGAKHFGFVELRTLMVATDWTDERAMSDLAIAGHARA 202
Query: 179 LLEWHNVSRFCGHCGEKTIPKEAGKLKQCSNASCKKRIYPRVDPVVIMLVIDRENDRVLL 238
LLEWHN+S FCGHCGEKT+P EAG+ KQCSNA CKKRIYPRVDPVVIMLVIDRENDR LL
Sbjct: 203 LLEWHNISHFCGHCGEKTVPMEAGRRKQCSNALCKKRIYPRVDPVVIMLVIDRENDRALL 262
Query: 239 SRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPC 298
SRQSRFVPRMWSC+AGFIEPGESLEEAVRRETWEETG+EVGEV+YH+SQPWPVGPNSMPC
Sbjct: 263 SRQSRFVPRMWSCLAGFIEPGESLEEAVRRETWEETGVEVGEVIYHSSQPWPVGPNSMPC 322
Query: 299 QLMVGFYAYAKSFEINVDKEELEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGV 358
QLM+GF+AYAKS EINVDKEELEDA+WHSREDVKKALTFAEY KAQRTAAAKVEQMCKGV
Sbjct: 323 QLMMGFFAYAKSVEINVDKEELEDAQWHSREDVKKALTFAEYKKAQRTAAAKVEQMCKGV 382
Query: 359 ERGQSLAADFNVESGELAPIFIPGPFAIAHHLISSWVYKDAPDGVQVQTAPSSTSMSNL 417
E+GQ+L+ADFNVESGELA +FIPGPFAIAHHLISSWV + +GV+ Q S S+SNL
Sbjct: 383 EKGQNLSADFNVESGELATMFIPGPFAIAHHLISSWVNQVPLNGVEAQLKQPSGSLSNL 441
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255566955|ref|XP_002524460.1| mutt/nudix hydrolase, putative [Ricinus communis] gi|223536248|gb|EEF37900.1| mutt/nudix hydrolase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15241252|ref|NP_197507.1| nudix hydrolase 19 [Arabidopsis thaliana] gi|68565923|sp|Q94A82.1|NUD19_ARATH RecName: Full=Nudix hydrolase 19, chloroplastic; Short=AtNUDT19; AltName: Full=NADH pyrophosphatase NUDT19; Flags: Precursor gi|15146278|gb|AAK83622.1| AT5g20070/F28I16_220 [Arabidopsis thaliana] gi|19699164|gb|AAL90948.1| AT5g20070/F28I16_220 [Arabidopsis thaliana] gi|110742131|dbj|BAE98994.1| hypothetical protein [Arabidopsis thaliana] gi|332005407|gb|AED92790.1| nudix hydrolase 19 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297808073|ref|XP_002871920.1| hypothetical protein ARALYDRAFT_488907 [Arabidopsis lyrata subsp. lyrata] gi|297317757|gb|EFH48179.1| hypothetical protein ARALYDRAFT_488907 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224122522|ref|XP_002330502.1| predicted protein [Populus trichocarpa] gi|222872436|gb|EEF09567.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449443109|ref|XP_004139323.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Cucumis sativus] gi|449520651|ref|XP_004167347.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224088057|ref|XP_002308309.1| predicted protein [Populus trichocarpa] gi|222854285|gb|EEE91832.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356514398|ref|XP_003525893.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255636719|gb|ACU18695.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356513933|ref|XP_003525662.1| PREDICTED: LOW QUALITY PROTEIN: nudix hydrolase 19, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 417 | ||||||
| TAIR|locus:2147665 | 438 | NUDX19 "nudix hydrolase homolo | 0.961 | 0.915 | 0.706 | 1.2e-161 | |
| UNIPROTKB|J9NRY3 | 460 | NUDT12 "Uncharacterized protei | 0.541 | 0.491 | 0.434 | 6.7e-45 | |
| UNIPROTKB|Q29RH3 | 444 | NUDT12 "Peroxisomal NADH pyrop | 0.541 | 0.509 | 0.424 | 7.6e-44 | |
| UNIPROTKB|E2RGZ2 | 426 | NUDT12 "Uncharacterized protei | 0.541 | 0.530 | 0.430 | 9.6e-44 | |
| UNIPROTKB|E7EM93 | 444 | NUDT12 "Peroxisomal NADH pyrop | 0.541 | 0.509 | 0.424 | 9.6e-44 | |
| UNIPROTKB|Q9BQG2 | 462 | NUDT12 "Peroxisomal NADH pyrop | 0.541 | 0.489 | 0.424 | 9.6e-44 | |
| MGI|MGI:1915243 | 462 | Nudt12 "nudix (nucleoside diph | 0.544 | 0.491 | 0.410 | 5.2e-43 | |
| UNIPROTKB|E1C2E5 | 465 | NUDT12 "Uncharacterized protei | 0.388 | 0.348 | 0.485 | 7.5e-42 | |
| ZFIN|ZDB-GENE-050417-164 | 433 | zgc:112020 "zgc:112020" [Danio | 0.498 | 0.480 | 0.415 | 8.4e-41 | |
| POMBASE|SPBC1778.03c | 376 | SPBC1778.03c "NADH pyrophospha | 0.513 | 0.569 | 0.382 | 7.3e-38 |
| TAIR|locus:2147665 NUDX19 "nudix hydrolase homolog 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1574 (559.1 bits), Expect = 1.2e-161, P = 1.2e-161
Identities = 296/419 (70%), Positives = 349/419 (83%)
Query: 1 MSTNLQTQAFAGNPIRSKTPKSTDPFSPTSALESLKTRLLDNTLHCQPQKHHXXXXXXXX 60
MS NL+T AFAGNP++SKTPKSTDPFSPTSA ESLKT + H P
Sbjct: 36 MSMNLKTHAFAGNPLKSKTPKSTDPFSPTSAFESLKTLIPVIPNHSTPS----------- 84
Query: 61 XXPDFKVLPFRKGRPLTYSGPGE--TAPVWHLGWISLGDCKIFLANSGIELKEEALVYLG 118
PDFKVLPF KGRPL +S G+ T P+WHLGW+SL DCK+ LA+ G++L E++LVYLG
Sbjct: 85 --PDFKVLPFSKGRPLVFSSGGDANTTPIWHLGWVSLADCKVLLASCGVDLNEDSLVYLG 142
Query: 119 SRSADDVVYWAIDVSDGDSLASEFGSKQLCFVELRTVMVATDWADQRAMADLAIAGHARA 178
+ +D+VYWA+D+++ D SE G ++LCFVELRT+MVA DWADQRAM +LAIAG+ARA
Sbjct: 143 PKLEEDLVYWAVDLAE-DGFVSELGGRKLCFVELRTLMVAADWADQRAMDELAIAGNARA 201
Query: 179 LLEWHNVSRFCGHCGEKTIPKEAGKLKQCSNASCKKRIYPRVDPVVIMLVIDRENDRVLL 238
LLEWHNVS+FCG CG KT PKEAG+ KQCS+ +C+KR+YPRVDPVVIMLVIDRENDR LL
Sbjct: 202 LLEWHNVSQFCGSCGSKTFPKEAGRRKQCSDETCRKRVYPRVDPVVIMLVIDRENDRALL 261
Query: 239 SRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPC 298
SRQSR+VPRMWSC+AGFIEPGESLEEAVRRETWEETGIEVG+VVYH+SQPWPVGP+SMPC
Sbjct: 262 SRQSRYVPRMWSCLAGFIEPGESLEEAVRRETWEETGIEVGDVVYHSSQPWPVGPSSMPC 321
Query: 299 QLMVGFYAYAKSFEINVDKEELEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGV 358
QLM+GF+A+AK+ +INVDKEELEDA+WHSRE+VKKAL AEY KAQRTAAAKVEQ+CKGV
Sbjct: 322 QLMLGFFAFAKTLDINVDKEELEDAQWHSREEVKKALAVAEYRKAQRTAAAKVEQICKGV 381
Query: 359 ERGQSLAADFNVESGELAPIFIPGPFAIAHHLISSWVYKDAPDGVQVQTAPSSTSMSNL 417
ER QSL+ DFN+ESGELAP+FIPGPFAIAHHLIS+WV APD V + + S+S+L
Sbjct: 382 ERSQSLSTDFNLESGELAPMFIPGPFAIAHHLISAWV-NQAPDDVHSKQQ-AGVSLSSL 438
|
|
| UNIPROTKB|J9NRY3 NUDT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RH3 NUDT12 "Peroxisomal NADH pyrophosphatase NUDT12" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGZ2 NUDT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EM93 NUDT12 "Peroxisomal NADH pyrophosphatase NUDT12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BQG2 NUDT12 "Peroxisomal NADH pyrophosphatase NUDT12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915243 Nudt12 "nudix (nucleoside diphosphate linked moiety X)-type motif 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C2E5 NUDT12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-164 zgc:112020 "zgc:112020" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1778.03c SPBC1778.03c "NADH pyrophosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016858001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00019982001 | • | 0.916 | |||||||||
| GSVIVG00033381001 | • | • | 0.906 | ||||||||
| GSVIVG00034123001 | • | 0.899 | |||||||||
| GSVIVG00030474001 | • | 0.899 | |||||||||
| GSVIVG00024584001 | • | 0.899 | |||||||||
| GSVIVG00019510001 | • | 0.899 | |||||||||
| GSVIVG00016539001 | • | 0.899 | |||||||||
| GSVIVG00006686001 | • | 0.899 | |||||||||
| GSVIVG00030263001 | • | 0.481 | |||||||||
| GSVIVG00013338001 | • | • | 0.443 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 417 | |||
| COG2816 | 279 | COG2816, NPY1, NTP pyrophosphohydrolases containin | 1e-72 | |
| cd03429 | 131 | cd03429, NADH_pyrophosphatase, NADH pyrophosphatas | 2e-64 | |
| PRK00241 | 256 | PRK00241, nudC, NADH pyrophosphatase; Reviewed | 3e-55 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 2e-22 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 8e-19 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 7e-14 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 7e-14 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 1e-12 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 3e-12 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 8e-12 | |
| cd04670 | 127 | cd04670, Nudix_Hydrolase_12, Members of the Nudix | 2e-11 | |
| cd04699 | 129 | cd04699, Nudix_Hydrolase_39, Members of the Nudix | 5e-11 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 1e-10 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 1e-10 | |
| PRK10729 | 202 | PRK10729, nudF, ADP-ribose pyrophosphatase NudF; P | 2e-09 | |
| cd04511 | 130 | cd04511, Nudix_Hydrolase_4, Members of the Nudix h | 3e-09 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 3e-09 | |
| cd04665 | 118 | cd04665, Nudix_Hydrolase_8, Members of the Nudix h | 4e-09 | |
| cd03675 | 134 | cd03675, Nudix_Hydrolase_2, Contains a crystal str | 1e-08 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 5e-08 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 8e-08 | |
| cd04685 | 133 | cd04685, Nudix_Hydrolase_26, Members of the Nudix | 1e-07 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 1e-07 | |
| TIGR00052 | 185 | TIGR00052, TIGR00052, nudix-type nucleoside diphos | 1e-07 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 1e-07 | |
| PRK08999 | 312 | PRK08999, PRK08999, hypothetical protein; Provisio | 1e-07 | |
| cd04695 | 131 | cd04695, Nudix_Hydrolase_36, Members of the Nudix | 2e-07 | |
| cd04667 | 112 | cd04667, Nudix_Hydrolase_10, Members of the Nudix | 3e-07 | |
| cd03674 | 138 | cd03674, Nudix_Hydrolase_1, Members of the Nudix h | 3e-07 | |
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 7e-07 | |
| pfam09296 | 91 | pfam09296, NUDIX-like, NADH pyrophosphatase-like r | 2e-06 | |
| cd04678 | 129 | cd04678, Nudix_Hydrolase_19, Members of the Nudix | 2e-06 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 3e-06 | |
| cd04691 | 117 | cd04691, Nudix_Hydrolase_32, Members of the Nudix | 3e-06 | |
| cd04669 | 121 | cd04669, Nudix_Hydrolase_11, Members of the Nudix | 4e-06 | |
| cd04671 | 123 | cd04671, Nudix_Hydrolase_13, Members of the Nudix | 4e-06 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 6e-06 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 7e-06 | |
| TIGR02705 | 156 | TIGR02705, nudix_YtkD, nucleoside triphosphatase Y | 7e-06 | |
| pfam09297 | 32 | pfam09297, zf-NADH-PPase, NADH pyrophosphatase zin | 3e-05 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 3e-05 | |
| cd04694 | 143 | cd04694, Nudix_Hydrolase_35, Members of the Nudix | 3e-05 | |
| cd04666 | 122 | cd04666, Nudix_Hydrolase_9, Members of the Nudix h | 4e-05 | |
| PRK15472 | 141 | PRK15472, PRK15472, nucleoside triphosphatase NudI | 7e-05 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 8e-05 | |
| cd03426 | 157 | cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse) | 1e-04 | |
| cd04672 | 123 | cd04672, Nudix_Hydrolase_14, Members of the Nudix | 1e-04 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 1e-04 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 2e-04 | |
| cd04689 | 125 | cd04689, Nudix_Hydrolase_30, Members of the Nudix | 2e-04 | |
| cd04697 | 126 | cd04697, Nudix_Hydrolase_38, Members of the Nudix | 3e-04 | |
| PRK05379 | 340 | PRK05379, PRK05379, bifunctional nicotinamide mono | 4e-04 | |
| cd04679 | 125 | cd04679, Nudix_Hydrolase_20, Members of the Nudix | 5e-04 | |
| PRK15009 | 191 | PRK15009, PRK15009, GDP-mannose pyrophosphatase Nu | 7e-04 | |
| cd04687 | 128 | cd04687, Nudix_Hydrolase_28, Members of the Nudix | 0.001 | |
| cd04700 | 142 | cd04700, DR1025_like, DR1025 from Deinococcus radi | 0.002 | |
| COG1443 | 185 | COG1443, Idi, Isopentenyldiphosphate isomerase [Li | 0.002 | |
| PRK10776 | 129 | PRK10776, PRK10776, nucleoside triphosphate pyroph | 0.003 | |
| PLN02325 | 144 | PLN02325, PLN02325, nudix hydrolase | 0.004 |
| >gnl|CDD|225373 COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 229 bits (585), Expect = 1e-72
Identities = 104/317 (32%), Positives = 143/317 (45%), Gaps = 63/317 (19%)
Query: 88 WHLGWISLGDCKIFLAN--------SGIELKEEALVYLGSRSADDVVYWAIDVSDGDSLA 139
W+ + K+ L + ++L EAL+ +G +A+ + + L
Sbjct: 18 DSTLWLVFSEGKLLLKDGELPFGAAENLDLVGEALLGIGEWG--GEPVFAVWLVEEIELP 75
Query: 140 SEFGSKQLCFVELRTVMVATDWADQRAMADLAIAGHARALLEWHNVSRFCGHCGEKTIPK 199
F V+LR+++ + +A A LLEW+ RFCG CG KT P+
Sbjct: 76 EPFE-----LVDLRSLL-----TELDE-GLFGLAARAVQLLEWYRSHRFCGRCGTKTYPR 124
Query: 200 EAGKLKQCSNASCKKRIYPRVDPVVIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPG 259
E G + C C +PR+DP VI+ VI D +LL+R R P M+S +AGF+EPG
Sbjct: 125 EGGWARVCPK--CGHEHFPRIDPCVIVAVIRG--DEILLARHPRHFPGMYSLLAGFVEPG 180
Query: 260 ESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPCQLMVGFYAYAKSFEINVDKEE 319
E+LE+AV RE +EE GI+V V Y SQPWP P LM+GF A S EI D+ E
Sbjct: 181 ETLEQAVAREVFEEVGIKVKNVRYVGSQPWP-----FPHSLMLGFMAEYDSGEITPDEGE 235
Query: 320 LEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGVERGQSLAADFNVESGELAPIF 379
LEDARW SR++V AL R +
Sbjct: 236 LEDARWFSRDEVLPAL--PPDGTIAR-------------------------------RLI 262
Query: 380 IPGPFAIAHHLISSWVY 396
P AIA LI +W
Sbjct: 263 EPTLAAIARELIKAWAE 279
|
Length = 279 |
| >gnl|CDD|239521 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >gnl|CDD|234699 PRK00241, nudC, NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182682 PRK10729, nudF, ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240041 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240051 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|220167 pfam09296, NUDIX-like, NADH pyrophosphatase-like rudimentary NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >gnl|CDD|204192 pfam09297, zf-NADH-PPase, NADH pyrophosphatase zinc ribbon domain | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|240029 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240045 cd04689, Nudix_Hydrolase_30, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|235436 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240035 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|184971 PRK15009, PRK15009, GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240043 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >gnl|CDD|224360 COG1443, Idi, Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215184 PLN02325, PLN02325, nudix hydrolase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 100.0 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 100.0 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 100.0 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.86 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.84 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.78 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.78 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.78 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.77 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.77 | |
| PLN02325 | 144 | nudix hydrolase | 99.76 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.75 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.75 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.75 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.75 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.74 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.74 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.74 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.74 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.74 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.73 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.73 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.73 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.73 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.72 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.72 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.72 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.71 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.71 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.71 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.71 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.71 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.7 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.7 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.7 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.7 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.69 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.69 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.69 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.69 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.69 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.68 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.68 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.67 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.67 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.67 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.67 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.66 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.65 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.64 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.63 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.62 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.62 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.62 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.61 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.61 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.61 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.6 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.6 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.59 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.59 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.59 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.58 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.58 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.57 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.56 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.55 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.53 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.5 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.5 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.49 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.48 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.47 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.44 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.44 | |
| PLN02709 | 222 | nudix hydrolase | 99.4 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.38 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.35 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.23 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.19 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.17 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.17 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.15 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.07 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.98 | |
| PF09296 | 98 | NUDIX-like: NADH pyrophosphatase-like rudimentary | 98.94 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 98.91 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.74 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 98.58 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 98.52 | |
| PLN02839 | 372 | nudix hydrolase | 98.46 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.43 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 98.4 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 97.64 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 97.62 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 96.9 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 96.77 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 95.97 | |
| COG1998 | 51 | RPS31 Ribosomal protein S27AE [Translation, riboso | 95.78 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 95.65 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 95.61 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 95.25 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 94.67 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 93.77 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 93.18 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 92.81 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 92.47 | |
| COG4111 | 322 | Uncharacterized conserved protein [General functio | 89.74 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 87.56 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 86.66 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 84.97 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 83.62 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 83.53 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 83.43 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 83.28 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 82.81 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 82.15 | |
| PF12677 | 49 | DUF3797: Domain of unknown function (DUF3797); Int | 81.45 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 81.31 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 81.12 | |
| PF09151 | 36 | DUF1936: Domain of unknown function (DUF1936); Int | 80.57 | |
| PRK13844 | 200 | recombination protein RecR; Provisional | 80.1 |
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-52 Score=400.05 Aligned_cols=260 Identities=41% Similarity=0.707 Sum_probs=215.8
Q ss_pred CeEEEEEeCCceeeecCCCCCCCceeeccccchhhHHHhhhcCcCcccccEEEeeeeeCCCeeEEEEecCCCCccccccc
Q 014873 64 DFKVLPFRKGRPLTYSGPGETAPVWHLGWISLGDCKIFLANSGIELKEEALVYLGSRSADDVVYWAIDVSDGDSLASEFG 143 (417)
Q Consensus 64 ~~~~l~f~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~Lg~~~~~~~~~~a~~~~~~~~~~~~~~ 143 (417)
.+++++|+++++++..++. | +..... ..+......++|.. ++.++|++.+......
T Consensus 19 ~~~~~~~~~~~l~l~~~~~---p--------~~~~~~------~~l~~~~~~~~~~~--~~~~v~~~~l~~~~~~----- 74 (279)
T COG2816 19 STLWLVFSEGKLLLKDGEL---P--------FGAAEN------LDLVGEALLGIGEW--GGEPVFAVWLVEEIEL----- 74 (279)
T ss_pred cceEEEEcCCcEEEecCCC---c--------cchhhc------CCchHHHhhhcccc--CCccceeeeccccccc-----
Confidence 7999999999999976432 1 111111 01123345667764 6678887755433321
Q ss_pred ccccchhhhHHHHhhcchhhhhhHHHHHHHHHHHHHHhhhhccCccccCCCcceeccCccceeecCCCCCCcccCCcCcE
Q 014873 144 SKQLCFVELRTVMVATDWADQRAMADLAIAGHARALLEWHNVSRFCGHCGEKTIPKEAGKLKQCSNASCKKRIYPRVDPV 223 (417)
Q Consensus 144 ~~~~~~~~lr~~~~~~~~~~~~~~~~~~~~~~A~~l~~W~~~~~fC~~CG~~~~~~~~g~~~~C~~~~C~~~~ypr~~pv 223 (417)
+.+..+++||+++..+ +...+.++++|.+|++|+++||||++||+++.+..+|++++|+ .|+..+|||++|+
T Consensus 75 ~~~~~~~~lR~l~~~~------~~~~~~~~~~a~~l~~w~~~~RFCg~CG~~~~~~~~g~~~~C~--~cg~~~fPR~dP~ 146 (279)
T COG2816 75 PEPFELVDLRSLLTEL------DEGLFGLAARAVQLLEWYRSHRFCGRCGTKTYPREGGWARVCP--KCGHEHFPRIDPC 146 (279)
T ss_pred CCccceeeHHHHhccC------CHHHHHHHHHHHHHHHHHhhCcCCCCCCCcCccccCceeeeCC--CCCCccCCCCCCe
Confidence 2467899999998643 4467899999999999999999999999999999999999998 5999999999999
Q ss_pred EEEEEEecCCCEEEEEEecCCCCCcEEeeeeeccCCCCHHHHHHHHHHHHhCCeeccEEEEEEeecCCCCCCCCcEEEEE
Q 014873 224 VIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPCQLMVG 303 (417)
Q Consensus 224 Vivlvi~~~~~kVLL~rr~~~~~g~WslPgG~VE~GEtleeAa~REv~EEtGl~v~~v~~~~s~~~~~~~~~~p~~l~i~ 303 (417)
|||+|++ ++++||.++.++++|+|++.+||||+|||+|+||+||++||+||+|++++|++||||| +|+++|++
T Consensus 147 vIv~v~~--~~~ilLa~~~~h~~g~yS~LAGFVE~GETlE~AV~REv~EE~Gi~V~~vrY~~SQPWP-----fP~SLMig 219 (279)
T COG2816 147 VIVAVIR--GDEILLARHPRHFPGMYSLLAGFVEPGETLEQAVAREVFEEVGIKVKNVRYVGSQPWP-----FPHSLMLG 219 (279)
T ss_pred EEEEEec--CCceeecCCCCCCCcceeeeeecccCCccHHHHHHHHHHHhhCeEEeeeeEEeccCCC-----Cchhhhhh
Confidence 9999998 4569999999888999999999999999999999999999999999999999999999 59999999
Q ss_pred EEEEEecccccCCcccccceEEEehhhHHHHhhhhhHHHHHHHHHHHHHHhhhhhccccccccccccccCCC-CCccCCc
Q 014873 304 FYAYAKSFEINVDKEELEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGVERGQSLAADFNVESGEL-APIFIPG 382 (417)
Q Consensus 304 f~a~~~~~~~~~~~~E~~~a~Wf~~del~~~L~~~~~~~a~~~a~~~l~~~~~~~er~~~~~~~~k~~~~~~-~~~~lP~ 382 (417)
|++.+.+++++.+..|+++++||+++|+..+|..+ +.. ..+..|+
T Consensus 220 f~aey~sgeI~~d~~Eleda~WFs~~evl~~L~~~----------------------------------~~~~~~li~~~ 265 (279)
T COG2816 220 FMAEYDSGEITPDEGELEDARWFSRDEVLPALPPD----------------------------------GTIARRLIEPT 265 (279)
T ss_pred heeeeccccccCCcchhhhccccCHhHHhhhcCCC----------------------------------CCcccccccch
Confidence 99999999999999999999999999977766531 111 2467799
Q ss_pred cchHHHHHHHHHhc
Q 014873 383 PFAIAHHLISSWVY 396 (417)
Q Consensus 383 ~faIA~~Li~~w~~ 396 (417)
..+||++++++|..
T Consensus 266 ~~~ia~~~~~~~~~ 279 (279)
T COG2816 266 LAAIARELIKAWAE 279 (279)
T ss_pred HHHHHHHHHhhhcC
Confidence 99999999999963
|
|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09296 NUDIX-like: NADH pyrophosphatase-like rudimentary NUDIX domain; InterPro: IPR015375 This entry represents the N-terminal domain found in NADH pyrophosphatase | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >COG4111 Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF12677 DUF3797: Domain of unknown function (DUF3797); InterPro: IPR024256 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF09151 DUF1936: Domain of unknown function (DUF1936); InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins | Back alignment and domain information |
|---|
| >PRK13844 recombination protein RecR; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 417 | ||||
| 1vk6_A | 269 | Crystal Structure Of Nadh Pyrophosphatase (1790429) | 3e-24 | ||
| 2gb5_A | 269 | Crystal Structure Of Nadh Pyrophosphatase (Ec 3.6.1 | 3e-24 | ||
| 3smd_A | 153 | Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM | 7e-05 | ||
| 2o1c_A | 150 | Structure Of The E. Coli Dihydroneopterin Triphosph | 3e-04 | ||
| 1viq_A | 220 | Crystal Structure Of Putative Adp Ribose Pyrophosph | 4e-04 | ||
| 1g0s_A | 209 | The Crystal Structure Of The E.Coli Adp-Ribose Pyro | 6e-04 |
| >pdb|1VK6|A Chain A, Crystal Structure Of Nadh Pyrophosphatase (1790429) From Escherichia Coli K12 At 2.20 A Resolution Length = 269 | Back alignment and structure |
|
| >pdb|2GB5|A Chain A, Crystal Structure Of Nadh Pyrophosphatase (Ec 3.6.1.22) (1790429) From Escherichia Coli K12 At 2.30 A Resolution Length = 269 | Back alignment and structure |
| >pdb|3SMD|A Chain A, Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM BACILLUS Thuringiensis Length = 153 | Back alignment and structure |
| >pdb|2O1C|A Chain A, Structure Of The E. Coli Dihydroneopterin Triphosphate Pyrophosphohydrolase Length = 150 | Back alignment and structure |
| >pdb|1VIQ|A Chain A, Crystal Structure Of Putative Adp Ribose Pyrophosphatase Length = 220 | Back alignment and structure |
| >pdb|1G0S|A Chain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase Length = 209 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 417 | |||
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 8e-85 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 1e-45 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 5e-34 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 7e-32 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 2e-27 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 1e-26 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 2e-24 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 4e-23 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 1e-21 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 1e-20 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 2e-20 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 6e-18 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 3e-17 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 3e-17 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 7e-17 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 8e-17 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 1e-16 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 2e-16 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 7e-16 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 8e-15 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 1e-14 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 3e-14 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 4e-14 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 7e-14 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 9e-14 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 1e-13 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 1e-13 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 2e-13 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 3e-13 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 1e-12 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 2e-12 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 5e-12 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 6e-12 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 8e-12 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 1e-11 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 2e-11 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 5e-11 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 2e-10 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 2e-10 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 3e-10 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 1e-09 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 1e-09 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 2e-09 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 2e-09 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 2e-08 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 9e-08 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 1e-07 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 1e-07 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 1e-07 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 2e-07 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 3e-07 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 3e-07 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 3e-07 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 6e-07 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 7e-07 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 1e-06 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 2e-06 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 2e-06 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 2e-06 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 4e-05 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 1e-04 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 2e-04 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 3e-04 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 7e-04 |
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Length = 269 | Back alignment and structure |
|---|
Score = 259 bits (663), Expect = 8e-85
Identities = 72/312 (23%), Positives = 123/312 (39%), Gaps = 83/312 (26%)
Query: 92 WISLGDCKIFLAN--------SGIELKEEALVYLGSRSADDVVYWAIDVSDGDSLASEFG 143
W+ + K++L + +L + + +G W +
Sbjct: 25 WVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEW--QGEPVWLVQQQRRHD------ 76
Query: 144 SKQLCFVELRTVMVATDWADQRAMADLAIAGHARALLEWHNVSRFCGHCGEKTIPKEAGK 203
+R V+ +AG L E++ ++CG+CG + P +
Sbjct: 77 -----MGSVRQVIDLDV-------GLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEW 124
Query: 204 LKQCSNASCKKRIYPRVDPVVIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPGESLE 263
CS+ C++R YP++ P +I+ + +D +LL++ +R + + +AGF+E GE+LE
Sbjct: 125 AMLCSH--CRERYYPQIAPCIIVAIRR--DDSILLAQHTRHRNGVHTVLAGFVEVGETLE 180
Query: 264 EAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPCQLMVGFYAYAKSFEINVDKEELEDA 323
+AV RE EE+GI+V + Y TSQPWP P LM F A S +I +D +EL +A
Sbjct: 181 QAVAREVMEESGIKVKNLRYVTSQPWP-----FPQSLMTAFMAEYDSGDIVIDPKELLEA 235
Query: 324 RWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGVERGQSLAADFNVESGELAPIFIPGP 383
W+ +D+ +P P
Sbjct: 236 NWYRYDDLP----------------------------------------------LLPPP 249
Query: 384 FAIAHHLISSWV 395
+A LI V
Sbjct: 250 GTVARRLIEDTV 261
|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Length = 212 | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Length = 217 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 100.0 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.93 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.88 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.88 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.87 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.85 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.84 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.82 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.8 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.8 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.78 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.78 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.77 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.76 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.76 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.76 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.76 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.76 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.76 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.76 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.75 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.75 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.75 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.75 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.74 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.74 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.74 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.74 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.74 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.73 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.72 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.72 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.71 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.71 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.71 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.7 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.7 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.7 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.7 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.7 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.69 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.69 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.68 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.68 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.68 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.68 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.68 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.68 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.67 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.67 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.67 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.66 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.66 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.66 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.66 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.65 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.65 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.65 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.64 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.64 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.63 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.62 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.6 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.6 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.56 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.55 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.5 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.48 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.47 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.42 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.36 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.35 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.31 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.27 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.01 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.83 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.54 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 97.05 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 93.81 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 87.8 | |
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 84.41 |
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-41 Score=329.26 Aligned_cols=247 Identities=28% Similarity=0.490 Sum_probs=206.0
Q ss_pred CCCCCCeEEEEEeCCceeeecCCCCCCCceeeccccchhhHHHhhhcCcCcccccEEEeeeeeCCCeeEEEEecCCCCcc
Q 014873 59 SSSSPDFKVLPFRKGRPLTYSGPGETAPVWHLGWISLGDCKIFLANSGIELKEEALVYLGSRSADDVVYWAIDVSDGDSL 138 (417)
Q Consensus 59 ~~~~~~~~~l~f~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~Lg~~~~~~~~~~a~~~~~~~~~ 138 (417)
..+...+++++|.++++|+.. ++ +.+....++.. .....+|||.. ++.+||+++++
T Consensus 17 ~~~~~~~~~~~~~~~~~~~~~-~~-------~~~~~~~~~~~---------~~~~~~~lg~~--~~~~~~~~~~~----- 72 (269)
T 1vk6_A 17 IEKLDHGWWVVSHEQKLWLPK-GE-------LPYGEAANFDL---------VGQRALQIGEW--QGEPVWLVQQQ----- 72 (269)
T ss_dssp CCTTCEEEEEEEETTEEECGG-GS-------CCEEEGGGGTC---------TTCEEEEEEES--SSSEEEEEECC-----
T ss_pred cCCCCCeEEEEEECCEEEEeC-CC-------cCCCChhhcCc---------ccCceEEEecc--CCEEEEEEecC-----
Confidence 456777999999999999954 21 11222222211 22467899985 68899999875
Q ss_pred cccccccccchhhhHHHHhhcchhhhhhHHHHHHHHHHHHHHhhhhccCccccCCCcceeccCccceeecCCCCCCcccC
Q 014873 139 ASEFGSKQLCFVELRTVMVATDWADQRAMADLAIAGHARALLEWHNVSRFCGHCGEKTIPKEAGKLKQCSNASCKKRIYP 218 (417)
Q Consensus 139 ~~~~~~~~~~~~~lr~~~~~~~~~~~~~~~~~~~~~~A~~l~~W~~~~~fC~~CG~~~~~~~~g~~~~C~~~~C~~~~yp 218 (417)
.+..+.+||.++.. ++.+++++++|++|.+|+++++|||.||+++....+++++.|+ +|+..+||
T Consensus 73 ------~~~~~~~lr~~~~~-------~~~~~~~~~~a~~l~~w~~~~~fC~~CG~~~~~~~~~~~~~C~--~C~~~~yp 137 (269)
T 1vk6_A 73 ------RRHDMGSVRQVIDL-------DVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCS--HCRERYYP 137 (269)
T ss_dssp ------CSSCEECTTHHHHH-------CHHHHHHHHHHHHHHHHHHTTSBCTTTCCBEEECSSSSCEEES--SSSCEECC
T ss_pred ------CCccchhHHHHhcC-------CHHHhHHHHHHHHHHhhhhcCCccccCCCcCccCCCceeeeCC--CCCCEecC
Confidence 13557789998753 2356789999999999999999999999999999999999997 69999999
Q ss_pred CcCcEEEEEEEecCCCEEEEEEecCCCCCcEEeeeeeccCCCCHHHHHHHHHHHHhCCeeccEEEEEEeecCCCCCCCCc
Q 014873 219 RVDPVVIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPC 298 (417)
Q Consensus 219 r~~pvVivlvi~~~~~kVLL~rr~~~~~g~WslPgG~VE~GEtleeAa~REv~EEtGl~v~~v~~~~s~~~~~~~~~~p~ 298 (417)
+++|+|++++.+ +++|||+||.+.+.|+|++|||+||+|||+++||+||++||||+++..+.++++++|++ +.
T Consensus 138 ~~~~~viv~v~~--~~~vLL~rr~~~~~g~w~lPgG~vE~GEt~eeAa~REv~EEtGl~v~~~~~~~~~~~~~-----~~ 210 (269)
T 1vk6_A 138 QIAPCIIVAIRR--DDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPF-----PQ 210 (269)
T ss_dssp CCEEEEEEEEEE--TTEEEEEEETTTCSSCCBCEEEECCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEET-----TE
T ss_pred CCCcEEEEEEEe--CCEEEEEEecCCCCCcEECCcCcCCCCCCHHHHHHHHHHHHhCceeeeEEEEEEEecCC-----CC
Confidence 999999887766 58999999998778999999999999999999999999999999999999999999984 56
Q ss_pred EEEEEEEEEEecccccCCcccccceEEEehhhHHHHhhhhhHHHHHHHHHHHHHHhhhhhccccccccccccccCCCCCc
Q 014873 299 QLMVGFYAYAKSFEINVDKEELEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGVERGQSLAADFNVESGELAPI 378 (417)
Q Consensus 299 ~l~i~f~a~~~~~~~~~~~~E~~~a~Wf~~del~~~L~~~~~~~a~~~a~~~l~~~~~~~er~~~~~~~~k~~~~~~~~~ 378 (417)
.+|++|.+.+..+++.++++|+.+++||++++++.
T Consensus 211 ~~~~~f~a~~~~~~~~~~~~E~~~~~W~~~~el~~--------------------------------------------- 245 (269)
T 1vk6_A 211 SLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPL--------------------------------------------- 245 (269)
T ss_dssp EEEEEEEEEEEECCCCCCTTTEEEEEEEETTSCCS---------------------------------------------
T ss_pred EEEEEEEEEECCCCcCCCCcceEEEEEEEHHHhhh---------------------------------------------
Confidence 79999999887777777778999999999998753
Q ss_pred cCCccchHHHHHHHHHhcC
Q 014873 379 FIPGPFAIAHHLISSWVYK 397 (417)
Q Consensus 379 ~lP~~faIA~~Li~~w~~~ 397 (417)
+|...+|++.||+.|+..
T Consensus 246 -l~~~~si~~~li~~~l~~ 263 (269)
T 1vk6_A 246 -LPPPGTVARRLIEDTVAM 263 (269)
T ss_dssp -CCCTTSHHHHHHHHHHHH
T ss_pred -cccCcHHHHHHHHHHHHH
Confidence 467789999999999853
|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 417 | ||||
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 2e-26 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 7e-20 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 1e-18 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 2e-18 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 1e-17 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 1e-17 | |
| d2b06a1 | 155 | d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s | 3e-17 | |
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 7e-17 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 1e-16 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 3e-15 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 4e-15 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 9e-15 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 2e-14 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 4e-14 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 1e-13 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 4e-13 | |
| d2fb1a2 | 147 | d.113.1.6 (A:3-149) Hypothetical protein BT0354, N | 5e-13 | |
| d1ktga_ | 137 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 2e-12 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 2e-12 | |
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 7e-12 | |
| d1g0sa_ | 209 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri | 8e-12 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 4e-11 | |
| d1puna_ | 129 | d.113.1.1 (A:) Nucleoside triphosphate pyrophospho | 5e-10 | |
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 7e-07 | |
| d1nqza_ | 187 | d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco | 3e-06 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 9e-06 | |
| d1x51a1 | 142 | d.113.1.3 (A:8-149) A/G-specific adenine DNA glyco | 0.002 |
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: NADH pyrophosphatase domain: NADH pyrophosphatase species: Escherichia coli [TaxId: 562]
Score = 100 bits (251), Expect = 2e-26
Identities = 43/115 (37%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
Query: 219 RVDPVVIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEV 278
++ P +I+ + +D +LL++ +R + + +AGF+E GE+LE+AV RE EE+GI+V
Sbjct: 1 QIAPCIIVAIRR--DDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKV 58
Query: 279 GEVVYHTSQPWPVGPNSMPCQLMVGFYAYAKSFEINVDKEELEDARWHSREDVKK 333
+ Y TSQPWP P LM F A S +I +D +EL +A W+ +D+
Sbjct: 59 KNLRYVTSQPWP-----FPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPL 108
|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Length = 129 | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 417 | |||
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.93 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.84 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.81 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.8 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.79 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.78 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.77 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.74 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.74 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.73 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.73 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.73 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.72 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.72 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.71 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.71 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.71 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.7 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.69 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.69 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.67 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.67 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.66 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.61 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.6 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.45 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.37 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.36 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.27 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 98.93 | |
| d1vk6a3 | 97 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 97.51 | |
| d1vk6a4 | 29 | NADH pyrophosphatase intervening domain {Escherich | 97.37 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 93.23 | |
| d1pvma3 | 36 | Hypothetical protein Ta0289 C-terminal domain {Arc | 83.22 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 81.44 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 80.77 |
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: NADH pyrophosphatase domain: NADH pyrophosphatase species: Escherichia coli [TaxId: 562]
Probab=99.93 E-value=1.4e-25 Score=192.57 Aligned_cols=125 Identities=39% Similarity=0.666 Sum_probs=109.3
Q ss_pred CcCcEEEEEEEecCCCEEEEEEecCCCCCcEEeeeeeccCCCCHHHHHHHHHHHHhCCeeccEEEEEEeecCCCCCCCCc
Q 014873 219 RVDPVVIMLVIDRENDRVLLSRQSRFVPRMWSCIAGFIEPGESLEEAVRRETWEETGIEVGEVVYHTSQPWPVGPNSMPC 298 (417)
Q Consensus 219 r~~pvVivlvi~~~~~kVLL~rr~~~~~g~WslPgG~VE~GEtleeAa~REv~EEtGl~v~~v~~~~s~~~~~~~~~~p~ 298 (417)
++.|+|++++.+ ++++||+||.+.++|.|++|||+||+|||+++||+||++||||+++....+++...+.. ..
T Consensus 1 ~i~paViv~i~~--~~~vLL~~~~~~~~g~w~lpGG~ve~GEt~~~aa~REl~EEtG~~~~~~~~~~~~~~~~-----~~ 73 (131)
T d1vk6a2 1 QIAPCIIVAIRR--DDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPF-----PQ 73 (131)
T ss_dssp CCEEEEEEEEEE--TTEEEEEEETTTCSSCCBCEEEECCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEET-----TE
T ss_pred CcccEEEEEEEe--CCEEEEEEeccCCCCCEecccCCCcCCCcHHHHHHHHHHHHhCCcccceeEEEEeccCc-----Cc
Confidence 478999888876 68999999988778999999999999999999999999999999999888888877663 46
Q ss_pred EEEEEEEEEEecccccCCcccccceEEEehhhHHHHhhhhhHHHHHHHHHHHHHHhhhhhccccccccccccccCCCCCc
Q 014873 299 QLMVGFYAYAKSFEINVDKEELEDARWHSREDVKKALTFAEYIKAQRTAAAKVEQMCKGVERGQSLAADFNVESGELAPI 378 (417)
Q Consensus 299 ~l~i~f~a~~~~~~~~~~~~E~~~a~Wf~~del~~~L~~~~~~~a~~~a~~~l~~~~~~~er~~~~~~~~k~~~~~~~~~ 378 (417)
.+++.|.+.....++.+++.|+.+++||++++++.
T Consensus 74 ~~~~~f~~~~~~~~~~~~~~E~~~~~W~~~~el~~--------------------------------------------- 108 (131)
T d1vk6a2 74 SLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPL--------------------------------------------- 108 (131)
T ss_dssp EEEEEEEEEEEECCCCCCTTTEEEEEEEETTSCCS---------------------------------------------
T ss_pred eEEEEEEEEEcCCcccCCCccEEEEEEEcHHHHhh---------------------------------------------
Confidence 78888888888788888889999999999988653
Q ss_pred cCCccchHHHHHHHHHhc
Q 014873 379 FIPGPFAIAHHLISSWVY 396 (417)
Q Consensus 379 ~lP~~faIA~~Li~~w~~ 396 (417)
+|+..+|+++||+.|+.
T Consensus 109 -l~~~~~i~r~li~~~l~ 125 (131)
T d1vk6a2 109 -LPPPGTVARRLIEDTVA 125 (131)
T ss_dssp -CCCTTSHHHHHHHHHHH
T ss_pred -CCCChHHHHHHHHHHHH
Confidence 57777999999999985
|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vk6a3 d.113.1.4 (A:0-96) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vk6a4 g.41.14.1 (A:97-125) NADH pyrophosphatase intervening domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pvma3 g.41.13.1 (A:143-178) Hypothetical protein Ta0289 C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|