Citrus Sinensis ID: 014876

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MVLLCKGVYSEILDSVLNRVVAEEALELDSPSDSVTNSNSAQKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
ccEEEcccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccccccEEEEEEEEEHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEcccHHHHHHHHHHHHcccccccccHHHHcccccccHHHHHHHHHHHcccccccccccccccccEEEEccccHHHHHHHHHHHcccccEEEEccccccEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEccccEEEEEEcccHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHccccEEEEEEccccEEEEEEEccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEccccHccccccEEccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccHHcccccccccccccccccccccccccccccccccccEEEcc
MVLLCKGVYSEILDSVLNRVVAEEaleldspsdsvtnsnsAQKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEGvkrvkgdsnsiklevtgmvdpwkIQELVEKETKKKVELIFPLTQMAAKRVDNQISEEKLKRKKKIhrndigskqteegTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDElkkdvviifpaevviptkkddgaaykkekdagttrkkdrddkatnkkddgnnatidkkYRGAITVYekfegpsmvykknegidavdektkgnatvdrkdkgttptdakstgsatsddkykdggrekgkdyvfndekdkaggrdtkqhrrdkdgsvmrnenpktylnydgrkvnneydyysplkysngidqmfsdenpnsycsil
MVLLCKGVYSEILDSVLNRVVAEEAleldspsdsvtnSNSAQKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEgvkrvkgdsnsiklevtgmvdpwkIQELVEKETKKKVELIFPltqmaakrvdnqiseeklkrkkkihrndigskqteegtyvmKIKLCCDSCNQKLRKIMkikgletvnmdvqedlvkvkgtvditevrsyikdelkkdvviifpaevviptkkddgaaykkekdagttrkkdrddkatnkkddgnnatidkkyrgaitvyekfegpsmvykknegidavdektkgnatvdrkdkgttptdakstgsatsddkykdggrekgkdyvfndekdkaggrdtkqhrrdkdgsvmrnenpktylnydgrkvnNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
MVLLCKGVYSEILDSVLNRVVAEEALELDSPSDSVTNSNSAQKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQelveketkkkvelIFPLTQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
*VLLCKGVYSEILDSVLNRVVAE************************KVADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMA*******************************GTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPT***************************************KKYRGAITVYEKFEGPSMVY***************************************************************************************YLNYDGRKVNNEYDYYSPLKYSNGI****************
****C*GVYSEILDSVL************************************VTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMAAKRVDNQI****************GSKQTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLE***************TVDI**V***************************************************************************************************************************************************************************************************DQMFSDENPNSYCSIL
MVLLCKGVYSEILDSVLNRVVAEEAL***************QKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKD**************************KDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTK*******************************GGREKGKDYVFNDEKDK*************DGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
MVLLCKGVYSEILDSVLNRVVAEEALEL*********************ADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQ*****************************QTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPA***************************************************IT*YEKFEGPSMVYKKNEGIDAVDEKTKG****DR*******************************************************GSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLLCKGVYSEILDSVLNRVVAEEALELDSPSDSVTNSNSAQKAISNKVADQLVTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQKLRKIMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEKTKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHRRDKDGSVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
356570770335 PREDICTED: uncharacterized protein LOC10 0.502 0.623 0.356 2e-19
356505250329 PREDICTED: uncharacterized protein LOC10 0.401 0.507 0.4 8e-18
388495726343 unknown [Lotus japonicus] 0.415 0.504 0.340 3e-16
449482425326 PREDICTED: uncharacterized protein LOC10 0.346 0.441 0.364 9e-16
449451040326 PREDICTED: uncharacterized protein LOC10 0.355 0.453 0.354 9e-16
449451042324 PREDICTED: uncharacterized protein LOC10 0.370 0.475 0.316 4e-15
356533189316 PREDICTED: copper-transporting ATPase 2- 0.399 0.525 0.335 6e-15
118487366344 unknown [Populus trichocarpa] 0.408 0.494 0.344 1e-14
118488613313 unknown [Populus trichocarpa] 0.423 0.562 0.338 1e-14
224118406343 predicted protein [Populus trichocarpa] 0.408 0.495 0.344 1e-14
>gi|356570770|ref|XP_003553557.1| PREDICTED: uncharacterized protein LOC100795652 [Glycine max] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 122/219 (55%), Gaps = 10/219 (4%)

Query: 54  VTFILIVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKK 113
           V   L +H    V  +   V+  EGV+ VK D +S KL V G +DP ++++ + ++T+KK
Sbjct: 29  VVLKLDMHCEGCVKKINRAVRHFEGVEDVKADLSSNKLTVIGKLDPAEVRDKLAEKTRKK 88

Query: 114 VELIFPLTQ--MAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKIKLCCDSCNQ 171
           VEL+ P  +   A  +   + +EEK   +KK        K  +E T V+KI+L CD C Q
Sbjct: 89  VELVSPQPKKDSAGDKPPEKKTEEKKTEEKKSEDKKAEEKAPKESTVVLKIRLHCDGCVQ 148

Query: 172 KLRKI-MKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTK 230
           K+RKI +K KG+E+VN++  +DLV VKGT+D+ E+  Y+ D+LK++V        V+P K
Sbjct: 149 KIRKIILKSKGVESVNIEGGKDLVSVKGTMDVKEIVPYLNDKLKRNV-------EVVPPK 201

Query: 231 KDDGAAYKKEKDAGTTRKKDRDDKATNKKDDGNNATIDK 269
           K+ G   K+ K+ G    K    K    +D      ++K
Sbjct: 202 KEGGDNKKENKEGGGGDSKKEGGKKQEGEDGAAKVEVNK 240

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356505250|ref|XP_003521405.1| PREDICTED: uncharacterized protein LOC100792662 [Glycine max] Back     alignment and taxonomy information
>gi|388495726|gb|AFK35929.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449482425|ref|XP_004156278.1| PREDICTED: uncharacterized protein LOC101231228 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451040|ref|XP_004143270.1| PREDICTED: uncharacterized protein LOC101221463 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451042|ref|XP_004143271.1| PREDICTED: uncharacterized protein LOC101221463 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356533189|ref|XP_003535150.1| PREDICTED: copper-transporting ATPase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|118487366|gb|ABK95511.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118488613|gb|ABK96119.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118406|ref|XP_002331474.1| predicted protein [Populus trichocarpa] gi|222873552|gb|EEF10683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
TAIR|locus:2057951386 AT2G36950 [Arabidopsis thalian 0.612 0.660 0.307 8.8e-20
TAIR|locus:2142614392 AT5G03380 [Arabidopsis thalian 0.286 0.303 0.369 5e-16
TAIR|locus:2153969319 AT5G24580 "AT5G24580" [Arabido 0.632 0.824 0.266 3.2e-10
TAIR|locus:2046183245 AT2G28090 [Arabidopsis thalian 0.367 0.624 0.303 7.3e-10
TAIR|locus:2163300290 AT5G50740 [Arabidopsis thalian 0.646 0.927 0.244 1.7e-08
TAIR|locus:2018768287 AT1G29000 [Arabidopsis thalian 0.593 0.860 0.205 3.6e-08
TAIR|locus:2167366355 FP3 "farnesylated protein 3" [ 0.610 0.715 0.244 1.5e-06
TAIR|locus:2029914141 AT1G29100 "AT1G29100" [Arabido 0.144 0.425 0.262 1.5e-06
TAIR|locus:2096204 577 AT3G05220 [Arabidopsis thalian 0.108 0.077 0.369 2e-05
TAIR|locus:2133544150 AT4G08570 "AT4G08570" [Arabido 0.288 0.8 0.264 3e-05
TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 8.8e-20, P = 8.8e-20
 Identities = 86/280 (30%), Positives = 132/280 (47%)

Query:    44 AISNKVADQLVTFILIV--HGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWK 101
             A +  VA  +  F+  V  H       ++  VK  +GVK V  D+   KL V G +DP K
Sbjct:    40 AAAPPVAAVVSAFVYKVDMHCEGCAKKIKRMVKHFDGVKDVTADTGGNKLLVVGKIDPVK 99

Query:   102 IQXXXXXXXXXXXXXIFPLTQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQT-EEGTYVM 160
             +Q               P  ++    V   + E+K     K       +    +E    +
Sbjct:   100 LQEKLEEKTKRKVVLANPPPKVEGP-VAAAVGEKKADGGDKEAAPPAPAPAAPKESVVPL 158

Query:   161 KIKLCCDSCNQKLRKI-MKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVI 219
             KI+L C+ C QK++KI +KIKG+ETV +D  +D+V VKGT+D+ E+   +  +LK+ V  
Sbjct:   159 KIRLHCEGCIQKIKKIILKIKGVETVAIDGAKDVVTVKGTIDVKELVPLLTKKLKRTV-- 216

Query:   220 IFPAEVVIPTKKDDGAAYKKEKDAGTT-RKKDRDDKATNK-KDDGNNATIDKKYRGAITV 277
                 E ++P KKDDGAA  K+ +A     KK+      N+ K +G++    KK  G    
Sbjct:   217 ----EPLVPAKKDDGAAENKKTEAAAPDAKKEAPSAGVNEAKKEGSDGGEKKKEVG---- 268

Query:   278 YEKFEGPSMVYKKNEGIDAVDEKTK-GNATVDRKDKGTTP 316
                 +G     KK EG D  ++K + G+    +KD G  P
Sbjct:   269 ----DGGE---KKKEGGDGGEKKKEAGDGGEKKKDGGGVP 301
GO:0005737 "cytoplasm" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
GO:0005507 "copper ion binding" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2029914 AT1G29100 "AT1G29100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.163.16.1
SubName- Full=Putative uncharacterized protein; (290 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 416
PRK10671 834 copA copper exporting ATPase; Provisional 99.29
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.14
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.14
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.09
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 99.01
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 98.96
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.88
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.76
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.73
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.3
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.28
PRK10671 834 copA copper exporting ATPase; Provisional 98.09
PLN02957238 copper, zinc superoxide dismutase 97.67
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.59
PLN02957238 copper, zinc superoxide dismutase 97.34
TIGR0000368 copper ion binding protein. This model describes a 97.05
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 96.83
TIGR0000368 copper ion binding protein. This model describes a 96.04
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 95.15
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 91.79
TIGR0205292 MerP mercuric transport protein periplasmic compon 85.17
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information 
Probab=99.29  E-value=4.7e-11  Score=132.69  Aligned_cols=157  Identities=11%  Similarity=0.171  Sum_probs=112.3

Q ss_pred             eEEEEEE-eecChhHHHHHHHHhhccCCceEEEeecCCceEEEEeecchhhhhHHHhhhcccccccccccchhhhccccc
Q 014876           52 QLVTFIL-IVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPLTQMAAKRVDN  130 (416)
Q Consensus        52 ~tvvlkV-gM~CagCA~KIEkALskL~GV~sV~VDlatkkVtV~g~vDpe~Lv~aI~kk~Gk~aeiIs~~p~~~~~~~~~  130 (416)
                      ++++|.| +|+|++|+.+|+++|.+++||..+.+++.  +..|.+..+++.+.+.+++ .||.+++..+...+... ..+
T Consensus         3 ~~~~l~V~gmtC~~C~~~i~~al~~~~gv~~v~v~~~--~~~v~~~~~~~~i~~~i~~-~Gy~~~~~~~~~~~~~~-~~~   78 (834)
T PRK10671          3 QTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSIT--EAHVTGTASAEALIETIKQ-AGYDASVSHPKAKPLTE-SSI   78 (834)
T ss_pred             eEEEEEECCcccHHHHHHHHHHHhcCCCcceEEEeee--EEEEEecCCHHHHHHHHHh-cCCcccccccccccccc-ccc
Confidence            5789999 79999999999999999999999999994  5566666688888888886 78988765421110000 000


Q ss_pred             chhHHHHHhhhcccccCCCCCCCcceEEEEEe-cCCChhhHHHHHHh-hcCCCceEEEeEcCCCEEEEEeccCHHHHHHH
Q 014876          131 QISEEKLKRKKKIHRNDIGSKQTEEGTYVMKI-KLCCDSCNQKLRKI-MKIKGLETVNMDVQEDLVKVKGTVDITEVRSY  208 (416)
Q Consensus       131 ~~~~~k~~d~~~~~~~~~e~~~~~~~tv~LkV-GM~Ca~Ca~kIEka-~kl~GV~sV~VNla~~kVTVtG~vdp~~Vl~~  208 (416)
                      ...+.+  ....   ...........++.+.| ||+|++|+..|++. ..++||.++.+|+.++++.|.+..++..+...
T Consensus        79 ~~~~~~--~~~~---~~~~~~~~~~~~~~l~V~Gm~Ca~Ca~~Ie~~L~~~~GV~~a~vnl~t~~~~V~~~~s~~~I~~~  153 (834)
T PRK10671         79 PSEALT--AASE---ELPAATADDDDSQQLLLSGMSCASCVSRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQA  153 (834)
T ss_pred             Cchhhh--hhhh---hccccccCcCceEEEEeCCcCcHHHHHHHHHHHhcCCCceeeeeecCCCeEEEEccCCHHHHHHH
Confidence            000000  0000   00000000113567889 99999999999999 99999999999999999888766778888888


Q ss_pred             HHHhcCCceE
Q 014876          209 IKDELKKDVV  218 (416)
Q Consensus       209 L~kktGk~Ae  218 (416)
                      ++ .+||.+.
T Consensus       154 I~-~~Gy~a~  162 (834)
T PRK10671        154 VE-KAGYGAE  162 (834)
T ss_pred             HH-hcCCCcc
Confidence            86 6899873

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
 Score = 43.3 bits (102), Expect = 9e-06
 Identities = 14/65 (21%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 157 TYVMKIKLCCDSCNQKLRK-IMKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKK 215
           T    +++ C SC   +RK +  + G++ V + +++ +V V  T+   EV++ ++    +
Sbjct: 20  TLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGT-GR 78

Query: 216 DVVII 220
             V+ 
Sbjct: 79  QAVLK 83
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.79
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.73
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.71
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.33
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.21
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.17
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.14
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.13
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.04
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.0
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.97
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.97
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.94
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.94
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.93
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.92
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.89
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.89
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.88
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.88
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.87
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.87
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.87
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.85
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.83
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.82
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.82
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.8
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.8
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.79
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.78
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.77
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.77
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.77
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.77
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.75
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.72
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.71
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.71
2kyz_A67 Heavy metal binding protein; structural genomics, 98.7
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.69
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.68
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.66
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.65
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.63
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.63
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.61
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.6
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.6
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.6
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.59
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.58
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.58
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.57
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.57
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.57
2kyz_A67 Heavy metal binding protein; structural genomics, 98.56
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.55
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.55
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.54
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.54
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.53
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.52
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.52
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.49
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.47
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.47
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.43
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.41
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.37
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.36
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.21
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.21
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.2
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.0
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.7
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=2.5e-18  Score=145.94  Aligned_cols=136  Identities=15%  Similarity=0.215  Sum_probs=110.4

Q ss_pred             ceEEEEEE-eecChhHHHHHHHHhhccCCceEEEeecCCceEEEEee---cchhhhhHHHhhhcccccccccccchhhhc
Q 014876           51 DQLVTFIL-IVHGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGM---VDPWKIQELVEKETKKKVELIFPLTQMAAK  126 (416)
Q Consensus        51 ~~tvvlkV-gM~CagCA~KIEkALskL~GV~sV~VDlatkkVtV~g~---vDpe~Lv~aI~kk~Gk~aeiIs~~p~~~~~  126 (416)
                      .+++.|.| ||+|++|+..|+++|..++||..+.+++.++++.|.+.   .++..+...+.. .||.+.++....     
T Consensus         3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~-~G~~~~~~~~~~-----   76 (149)
T 2ew9_A            3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQD-LGFEAAVMEDYA-----   76 (149)
T ss_dssp             CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHHH-HTCEEEECSCSC-----
T ss_pred             cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHhc-CCCceEeecccc-----
Confidence            45678999 79999999999999999999999999999999999863   344566677765 577553221100     


Q ss_pred             ccccchhHHHHHhhhcccccCCCCCCCcceEEEEEe-cCCChhhHHHHHHh-hcCCCceEEEeEcCCCEEEEEe---ccC
Q 014876          127 RVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVMKI-KLCCDSCNQKLRKI-MKIKGLETVNMDVQEDLVKVKG---TVD  201 (416)
Q Consensus       127 ~~~~~~~~~k~~d~~~~~~~~~e~~~~~~~tv~LkV-GM~Ca~Ca~kIEka-~kl~GV~sV~VNla~~kVTVtG---~vd  201 (416)
                                                ....++.|.| ||+|++|+++|+++ .+++||.++.||+.+++++|..   .++
T Consensus        77 --------------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~  130 (149)
T 2ew9_A           77 --------------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIG  130 (149)
T ss_dssp             --------------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSC
T ss_pred             --------------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCC
Confidence                                      0113578999 99999999999999 9999999999999999999972   367


Q ss_pred             HHHHHHHHHHhcCCceEE
Q 014876          202 ITEVRSYIKDELKKDVVI  219 (416)
Q Consensus       202 p~~Vl~~L~kktGk~Aei  219 (416)
                      ++.|++.|. .+||.+.+
T Consensus       131 ~~~i~~~i~-~~Gy~~~~  147 (149)
T 2ew9_A          131 PRDIIKIIE-EIGFHASL  147 (149)
T ss_dssp             HHHHHHHHH-HHTCEEEC
T ss_pred             HHHHHHHHH-hCCCceEe
Confidence            889999996 78998854
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 416
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 3e-04
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 0.001
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 0.002
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 36.7 bits (85), Expect = 3e-04
 Identities = 10/57 (17%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 157 TYVMKIKLCCDSCNQKLRKIMK--IKGLETVNMDVQEDLVKVKGTVDITEVRSYIKD 211
            Y   + + C  C+  + K++      +  +++ +++ LV V  T+    +   IK 
Sbjct: 5   HYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKK 61
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.47
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.44
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.43
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.36
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.34
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.34
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.32
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.31
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.3
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.3
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.28
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.25
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.24
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.23
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.2
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.19
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.17
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.16
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.12
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.11
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.11
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.1
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.05
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.02
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.02
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.01
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.96
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.94
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.47  E-value=8.3e-14  Score=108.16  Aligned_cols=64  Identities=17%  Similarity=0.468  Sum_probs=60.5

Q ss_pred             eEEEEEecCCChhhHHHHHHh-hcCCCceEEEeEcCCCEEEEEeccCHHHHHHHHHHhcCCceEEe
Q 014876          156 GTYVMKIKLCCDSCNQKLRKI-MKIKGLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVII  220 (416)
Q Consensus       156 ~tv~LkVGM~Ca~Ca~kIEka-~kl~GV~sV~VNla~~kVTVtG~vdp~~Vl~~L~kktGk~Aei~  220 (416)
                      .+++|.|+|+|++|+++|+++ .+++||.++.||+.+++++|+|.+++++|+++|+ ++||+|.|+
T Consensus         6 ~~~~f~V~M~C~~C~~~Iek~l~~~~gV~~v~vdl~~~~v~V~~~~~~~~i~~~I~-~~G~~A~l~   70 (72)
T d1qupa2           6 YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLR-NCGKDAIIR   70 (72)
T ss_dssp             EEEEEECCCCSTTHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHH-HTTCCCEEE
T ss_pred             EEEEEEEccCCHHHHHHHHHHHhcCCCeeEEEEECCCCEEEEEeeCCHHHHHHHHH-HhCCCEEEe
Confidence            467899999999999999999 9999999999999999999999999999999996 799999775
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure