Citrus Sinensis ID: 014886

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------

MLSVGFYLPFNNIKPQKPICQMASSPPAAAAPTSFSFKNLTQTFTVDVQRAENRPLNVPLIAPFTIATSRLDQVENVAIRIELSNGCVGWGEAPVLPHVTAEDQQTAMVKASEACEVLKESPAMALGSVFGVVAGLLPGHQFASVRAAVEMALIDAVAKSVSMPLWRLFGGVSNTITTDITIPIVSPAEAAELASKYRKQGFTTLKLKVGKNLKEDIEVLRAIRAVHPDSSFILDANEGYKPQEAVEVLEKLYEMGVTPVLFEQPVHRDDWEGLGHVSHIAKDKFGVSVAADESCRSLDDVKKIVKGNLADVINIKLAKVGVLGALEIIEVVRASGLNLMIGGMVETRLAMGFAGHLSAGLGCFKFIDLDTPLLLSEDPVLDGYEVSGAVYKFTNARGHGGFLHWDNIAWGLQTSE

cccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEcccccEEEccEEEEEEEEEEEEEEEccccEEEECccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHcccccccEEEEEEECcccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccccEEccccccccHHHHccccHHHcccccccEEEccccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHcccccccEECcccccccccccccccEEECccEEEccccccccEEcccHHHHHHHHccc

**SVGFYLPFNNIK*****************P*SFSFKNLTQTFTVDVQRAENRPLNVPLIAPFTIATSRLDQVENVAIRIELSNGCVGWGEAPVLPHVTAEDQQTAMVKASEACEVLKESPAMALGSVFGVVAGLLPGHQFASVRAAVEMALIDAVAKSVSMPLWRLFGGVSNTITTDITIPIVSPAEAAELASKYRKQGFTTLKLKVGKNLKEDIEVLRAIRAVHPDSSFILDANEGYKPQEAVEVLEKLYEMGVTPVLFEQPVHRDDWEGLGHVSHIAKDKFGVSVAADESCRSLDDVKKIVKGNLADVINIKLAKVGVLGALEIIEVVRASGLNLMIGGMVETRLAMGFAGHLSAGLGCFKFIDLDTPLLLSEDPVLDGYEVSGAVYKFTNARGHGGFLHWDNIAWGLQ***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
L-Ala-D/L-Glu epimerase	Catalyzes the epimerization of L-Ala-D-Glu to L-Ala-L-Glu and has probably a role in the metabolism of the murein peptide, of which L-Ala-D-Glu is a component. Is also able to catalyze the reverse reaction and the epimerization of the other Ala-X dipeptides L-Ala-L-Asp, L-Ala-L-Leu, L-Ala-L-Met, and L-Ala-L-Ser. Is not able to epimerize other L-Ala-X dipeptides. Is also active with L-Ser-L-Glu and, oddly, L-Pro-L-Glu, but not with L-Glu-L-Glu, L-Lys-L-Glu, L-Lys-L-Ala, or D-Ala-D-Ala.	probable	O34508

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QDE, chain A
Confidence level:very confident
Coverage over the Query: 46-62,74-415
View the alignment between query and template
View the model in PyMOL