Citrus Sinensis ID: 014893

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------

MNLNANMLQAQRSRFNSKTFSLTISKHNIPVLPRNRSLSFSTSWCPVHFRSISHSNLKFGSSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLNQEFSLVNILKQSNSFLPHVVLGSTMLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKPILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPPLSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKALQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE

ccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc

*********AQRSRFNSKTFSLTISKHNIPVLPRNRSLSFSTSWCPVHFRSISHSNLKFG******************************NQVLNQEFSLVNILKQSNSFLPHVVLGSTMLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKPILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPPLSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKALQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable sodium/metabolite cotransporter BASS5, chloroplastic	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	confident	Q650U0
Probable sodium/metabolite cotransporter BASS6, chloroplastic	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	confident	Q8VYY4
Probable sodium/metabolite cotransporter BASS5, chloroplastic	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	probable	B8BDK4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZUX, chain A
Confidence level:very confident
Coverage over the Query: 100-415
View the alignment between query and template
View the model in PyMOL