Citrus Sinensis ID: 014918

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------

MPDNRQVKSNAVANQSADNIEEAIWRLKIHDNQEGGGVAQASPYPARPGEPDCLFYRRTGLCGYGSNCRFNHPAYAAQGAQYREELPERNGQPDCGYYLKTGTCKYGSTCKYHHPKDRNGAGPVSFNILGLPMRQDEKSCPYYMRTGSFLPSSGLQYAGSLPTWSLQRAPYLSSRLQGTQSYMPLIVSPSQGIVPAPGWNTYMGNIGPLSPTSIAGSNLIYSSRNQGDLGAGAQMHILSASSQNLPERPDQPDCRYYMNTGTCKYGADCKFHHPKERIAQSAASNIGPLGLPSRPGQAICSNYSMYGICKFGPTCRFDHPYAGYPINYGLSLPPLSILDSSLMNHQAISATHSIETSPDASSKIPNWVQNSDAVSVQHQNPDMKNSTTKNSDDSSKVDHPPHSVPNCSEPPHDQSN

ccccHHcccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**************************************************PDCLFYRRTGLCGYGSNCRFNHPAYA***************QPDCGYYLKTGTCKYGSTCKYHHPKDRNGAGPVSFNILGLPMRQDEKSCPYYMRTGSFLPSSGLQYAGSLP*W***********LQ*TQSY*P*********************************************************************CRYYMNTGTCKYGADCKFHHPKE*I**********L*****PGQAICSNYSMYGICKFGPTCRFDHPY***********************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 3	Possesses RNA-binding and ribonuclease activities in vitro.	probable	Q94AD9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 248-290
View the alignment between query and template
View the model in PyMOL

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 46-85
View the alignment between query and template
View the model in PyMOL

Template: 2CQE, chain A
Confidence level:very confident
Coverage over the Query: 42-73,92-126
View the alignment between query and template
View the model in PyMOL