Citrus Sinensis ID: 014925


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MSCSYLTTWVSSKSNLSSHLLHLNQNSVDYLCNFSSRKYPSKSSVFTPIRCGLRELKERLNTVKNTQKITEAMKLVAAARVRKAQEAVISSRPFVEKLVEFLYVINEQLQLDDIDVPLTNIRPVKKVAIVIITGDRGLCGGFNKAVIKKAENRMVELKDMGLDCVVISVGKKGNAYFRHRSNVSVIRCIEGEGFYTVKEAQTIADNVFSLFVSEEVDKVELVYTKFVSLVKSDPVIHTLLPLSMKGVICNENGMCVDAVEDELFRLTTNEGKMIVERDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRALQESFASEVAARMSAMSTATDNADELKKNLSVAYNQERQAKITGELLEIVAGAEALTQIRLRVPSFHGHVSFLHIIWLNHCLDCVNCRTMWDVLQLDESP
cccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccCEEEEECcccccccccccccccccHHHHHHHHHHccccccHHHcccccccccccccccEECccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccHHHHccccccc
*********************************************FTPI*CGLRELKERLNTVKNTQKITEAMKLVAAARVRKAQEAVISSRPFVEKLVEFLYVINEQLQLDDIDVPLTNIRPVKKVAIVIITGDRGLCGGFNKAVIKKAENRMVELKDMGLDCVVISVGKKGNAYFRHRSNVSVIRCIEGEGFYTVKEAQTIADNVFSLFVSEEVDKVELVYTKFVSLVKSDPVIHTLLPLSMKGVICNENGMCVDAVEDELFRLTTNEGKMIVERDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRALQESFASEVAARMSAMSTATDNADELKKNLSVAYNQERQAKITGELLEIVAGAEALTQIRLRVPSFHGHVSFLHIIWLNHCLDCVNCRTMWDVLQLD***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCSYLTTWVSSKSNLSSHLLHLNQNSVDYLCNFSSRKYPSKSSVFTPIRCGxxxxxxxxxxxxxxxxxxxxxKLVAAARVRKAQEAVISSRPFVEKLVEFLYVINEQLQLDDIDVPLTNIRPVKKVAIVIITGDRGLCGGFNKAVIKKAENRMVELKDMGLDCVVISVGKKGNAYFRHRSNVSVIRCIEGEGFYTVKEAQTIADNVFSLFVSEEVDKVELVYTKFVSLVKSDPVIHTLLPLSMKGVICNENGMCVDAVEDELFRLTTNEGKMIVERDSVTFNKGELSPLMLFEQDPAQILDAMMPLYMNSQILRALQESFASEVAARMSAxxxxxxxxxxxxxxxxxxxxxERQAKITGELLEIVAGAEALTQIRLRVPSFHGHVSFLHIIWLNHCLDCVNCRTMWDVLQLDESP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase gamma chain 1, chloroplastic Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex.probableQ01908
ATP synthase gamma chain, chloroplastic Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex.probableP29790
ATP synthase gamma chain Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex.probableB7KKR3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QE7, chain G
Confidence level:very confident
Coverage over the Query: 52-98,115-244,304-353
View the alignment between query and template
View the model in PyMOL
Template: 3OE7, chain G
Confidence level:confident
Coverage over the Query: 53-113,125-235,252-294,307-371
View the alignment between query and template
View the model in PyMOL