Citrus Sinensis ID: 014934

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----

MDDPTESPQLNLPPTMSLQPLTPPSDHISRMINANHHQSPSRAIYSDRFIPSRSSSNFDLFNISQPSPNSPAVTDSHKDDNSGTYTALLRAALFGPETPEKKDVLGPPSGRNIFRFKSETRRSLHSLSPFGFDDDVASGVSHSPVKAPRKVPRSPYKILDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWANRNTHLAVGTSHGKVQIWDASRCKRVRTMEGHRLRVGALAWSSSLLSSGSRDKSILQRDIRAQEDFVSKLSGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYCEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNTHLSCMDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKVL

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccEEECccccccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEcccccccccEEEEEEcccccEEEEECcccEEEEEEccccCEEEEcccccccEEEEEEcccEEEEECccccEEEEEcccccccccccccccccEEEEEEcccccEEEEECccccEEEEEcccccCEEEEccccccEEEEEEccccccEEEECcccccccEEEEEcccccCEEEEcccccEEEEEEcccccEEEEccccccccEEEEEcccccccc

************************************************FIPSRSSSNF***************************TALLRAALFGPE****************************************************KVPRSPYKILDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWANRNTHLAVGTSHGKVQIWDASRCKRVRTMEGHRLRVGALAWSSSLLSSGSRDKSILQRDIRAQEDFVSKLSGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYCEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNTHLSCMDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKVL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein FIZZY-RELATED 2	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C). Necessary and sufficient for endoreduplication and correct cell expansion.	confident	Q8L3Z8
Fizzy-related protein homolog	Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.	probable	Q9UM11
Protein FIZZY-RELATED 1	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	probable	Q8VZS9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 148-414
View the alignment between query and template
View the model in PyMOL