Citrus Sinensis ID: 014979


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----
MSFKSIVRELKEMRDGIGSKSRRGVEAGKHWHSRKQTHIAPDQALLSSDSSQHSLWANLPPELLLDIVRRVEESETSWPARAVVVFCASVCRTWREVTKEIVQTPEQCGRLTFPISLKQPGPHESPIQCFIRRDRGTSTYHLCFGLVPSEDGSDKLLLAARKIRRATCTDFVISLAANDFSRASNSYVGKLRSNFLGTKFTIYDSQPPCDMTIQPTGGMSRRFHSKQVSPRLPAYNYRIGSISYELNVLRTRGPRRMNCIMDTIPFSSIEEGGAAPTPTSFAQSFDEQFFSFTSLKGKEPITYSSSPSPSLSLASTPGSPQPLALKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVEPSHNVPLAEQEKVILQFGKIGKDIFTMDYHYPLSAFQAFAICLSSFDTKPACE
ccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccEEEEEccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEEECcccccccEECcCCccccccEEEEEEEEccccccEEEEEEccccccccccccccccEEccccccEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEEEccccEEEEccccEEEEEccccccccccccccEEEEEEEEEcccEEEEEEcccccHHHHHHHHHHccccccccc
*SFKSIVRELKE******************************************LWANLPPELLLDIVRRVEESETSWPARAVVVFCASVCRTWREVTKEIVQTPEQCGRLTFPISLKQPGPHESPIQCFIRRDRGTSTYHLCFGLVPSEDGSDKLLLAARKIRRATCTDFVISLAANDFSRASNSYVGKLRSNFLGTKFTIYDSQPPC*********************RLPAYNYRIGSISYELNVLRTRGPRRMNCIMDTIPFSS***************************************************PQPLALKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVEP*******EQEKVILQFGKIGKDIFTMDYHYPLSAFQAFAICLSSFDTKPACE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFKSIVRELKEMRDGIGSKSRRGVEAGKHWHSRKQTHIAPDQALLSSDSSQHSLWANLPPELLLDIVRRVEESETSWPARAVVVFCASVCRTWREVTKEIVQTPEQCGRLTFPISLKQPGPHESPIQCFIRRDRGTSTYHLCFGLVPSEDGSDKLLLAARKIRRATCTDFVISLAANDFSRASNSYVGKLRSNFLGTKFTIYDSQPPCDMTIQPTGGMSRRFHSKQVSPRLPAYNYRIGSISYELNVLRTRGPRRMNCIMDTIPFSSIEEGGAAPTPTSFAQSFDEQFFSFTSLKGKEPITYSSSPSPSLSLASTPGSPQPLALKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVEPSHNVPLAEQEKVILQFGKIGKDIFTMDYHYPLSAFQAFAICLSSFDTKPACE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubby-like F-box protein 2 probableQ8GVE5
Tubby-like F-box protein 5 probableQ6Z2G9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 117-211,227-304,315-409
View the alignment between query and template
View the model in PyMOL
Template: 1C8Z, chain A
Confidence level:confident
Coverage over the Query: 119-301,323-415
View the alignment between query and template
View the model in PyMOL
Template: 2E31, chain A
Confidence level:confident
Coverage over the Query: 81-99
View the alignment between query and template
View the model in PyMOL