Citrus Sinensis ID: 014987

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----
MRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF
cCCccccccccccccccccccccccHHHHHHHHHHHHHcEEEEEccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHcccccEEEEccccccccccccHHHHHHHHHHccEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccEEEccccccccccEEEEEEEEEcccccccEEEEEEECccccccccccEEccccEEEEccccEEEEEEEEcccccEEEEcccccEEEcccCEEEEEcccccEEEEEEEEEEEEc
MRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLGMFDGEPSAQPFGNLGPRDVCTPAHQQLALQAAHQGIVLLKNSARTLPLSTLRHHTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGISRYAKTIHQAGCFGVACNGNQLIGAAEVAARQADATVLVMGLDQSIEAEFIDRAGLLLPGRQQELVSRVAKASRGPVVLVLMCGGPVDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTDMRMRAARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQANLEGIKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative beta-D-xylosidase (Fragment) May be involved in cell wall metabolism, related to senescence.probableP83344
Beta-D-xylosidase 1 Involved in pectic arabinan modification in mucilage secretory cells. Acts also as a beta-D-xylosidase during the remodeling of xylans in vascular development.probableQ9FGY1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ABZ, chain A
Confidence level:very confident
Coverage over the Query: 1-279,307-410
View the alignment between query and template
View the model in PyMOL
Template: 3ZYZ, chain A
Confidence level:very confident
Coverage over the Query: 1-411
View the alignment between query and template
View the model in PyMOL