Citrus Sinensis ID: 015015

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----

MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV

ccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHcccEEEEEcccccEEcccccccccccccCEECcccccccEEEEEccccccccEEEEcccccccccEEEEcccccccccEEEccEEEEccEEccccccccHHHHcccccccccccccccccccEEECccccEEEEEEcccccEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc

******************YEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDA***DMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQE****TGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFT**************************************************FNLNLKG******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chaperone protein dnaJ 15	Have a continuous role in plant development probably in the structural organization of compartments (By similarity). Seems to be involved in early gravitropic signal transduction within the gravity-perceiving cells (statocytes), where it influences pH changes and auxin distribution. Probably affects the localization and/or activity of auxin efflux carrier components (PIN proteins) or other proteins involved in lateral auxin transport.	confident	Q9ZSY2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 117-141,179,191-199,211-288
View the alignment between query and template
View the model in PyMOL

Template: 1NLT, chain A
Confidence level:confident
Coverage over the Query: 114-179,191-287
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 288-345
View the alignment between query and template
View the model in PyMOL