Citrus Sinensis ID: 015015
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 414 | ||||||
| 297841555 | 410 | hypothetical protein ARALYDRAFT_894602 [ | 0.980 | 0.990 | 0.838 | 0.0 | |
| 15221381 | 410 | chaperone protein dnaJ 15 [Arabidopsis t | 0.980 | 0.990 | 0.830 | 0.0 | |
| 225424031 | 415 | PREDICTED: chaperone protein dnaJ 15 [Vi | 0.995 | 0.992 | 0.857 | 0.0 | |
| 110737915 | 410 | ARG1 protein [Arabidopsis thaliana] | 0.980 | 0.990 | 0.828 | 0.0 | |
| 224108448 | 406 | predicted protein [Populus trichocarpa] | 0.978 | 0.997 | 0.866 | 0.0 | |
| 449434604 | 409 | PREDICTED: chaperone protein dnaJ 15-lik | 0.980 | 0.992 | 0.828 | 0.0 | |
| 224101759 | 407 | predicted protein [Populus trichocarpa] | 0.978 | 0.995 | 0.826 | 0.0 | |
| 357444703 | 414 | Chaperone protein dnaJ [Medicago truncat | 0.987 | 0.987 | 0.859 | 0.0 | |
| 449458757 | 413 | PREDICTED: chaperone protein dnaJ 15-lik | 0.980 | 0.983 | 0.812 | 0.0 | |
| 449513297 | 413 | PREDICTED: LOW QUALITY PROTEIN: chaperon | 0.980 | 0.983 | 0.812 | 0.0 |
| >gi|297841555|ref|XP_002888659.1| hypothetical protein ARALYDRAFT_894602 [Arabidopsis lyrata subsp. lyrata] gi|297334500|gb|EFH64918.1| hypothetical protein ARALYDRAFT_894602 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 729 bits (1883), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 347/414 (83%), Positives = 387/414 (93%), Gaps = 8/414 (1%)
Query: 1 MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
M + K+EGSSAP RRDPYEVLCVS+D++DQEIK+AYRKLALKYHPDKN +NP+A+ELFK
Sbjct: 1 MSAKKLEGSSAPANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFK 60
Query: 61 EVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
EVA+SYSILSDPEKRRHYDNAGFEA+DA+GMDMEIDLSNLGTVNTMFAALFSKLGVPIKT
Sbjct: 61 EVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
Query: 121 TISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQ 180
T+SANVLEEA+NGTVTVRPLPIGTSVSGKVEKQCAHFFGVTI++QQAE+G+VVRVTSTAQ
Sbjct: 121 TVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRVTSTAQ 180
Query: 181 SKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPES 240
SKFKLLYFEQD++GGYGLALQE+SEKTGKVTSAGMYFLHFQVYRMDST+NA+A AKDPES
Sbjct: 181 SKFKLLYFEQDSSGGYGLALQEESEKTGKVTSAGMYFLHFQVYRMDSTVNALAAAKDPES 240
Query: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQ 300
AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTA+YTIEALCAK+YED ++KLK+IEAQ
Sbjct: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTIEALCAKTYEDTTEKLKEIEAQ 300
Query: 301 ILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSS 360
ILRKR ELR+FE EYRKALARFQE TNRY+QEKQ+VDELLKQRD IHS+F+V KT
Sbjct: 301 ILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKT----- 355
Query: 361 VSGNNLSNGSSSKVPGEDSK--GESPAEDGSSDGKDKSAKKKWFNLNLKGSDKK 412
SGNNLSNGSSSK GE+SK G+S E+G ++ +DKS K+KWFNLNLKGSDKK
Sbjct: 356 PSGNNLSNGSSSKAQGEESKGDGDSAGEEGGTESRDKS-KRKWFNLNLKGSDKK 408
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15221381|ref|NP_177004.1| chaperone protein dnaJ 15 [Arabidopsis thaliana] gi|67462423|sp|Q9ZSY2.1|DNJ15_ARATH RecName: Full=Chaperone protein dnaJ 15; Short=AtDjB15; Short=AtJ15; AltName: Full=Protein ALTERED RESPONSE TO GRAVITY; Short=AtARG1 gi|6714354|gb|AAF26045.1|AC015986_8 ARG1 protein (Altered Response to Gravity); 32591-35072 [Arabidopsis thaliana] gi|4249662|gb|AAD13758.1| Altered Response to Gravity [Arabidopsis thaliana] gi|98960981|gb|ABF58974.1| At1g68370 [Arabidopsis thaliana] gi|332196665|gb|AEE34786.1| chaperone protein dnaJ 15 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225424031|ref|XP_002283449.1| PREDICTED: chaperone protein dnaJ 15 [Vitis vinifera] gi|147769068|emb|CAN72503.1| hypothetical protein VITISV_027277 [Vitis vinifera] gi|297737795|emb|CBI26996.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|110737915|dbj|BAF00895.1| ARG1 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224108448|ref|XP_002314850.1| predicted protein [Populus trichocarpa] gi|222863890|gb|EEF01021.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449434604|ref|XP_004135086.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] gi|449493448|ref|XP_004159293.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224101759|ref|XP_002312410.1| predicted protein [Populus trichocarpa] gi|222852230|gb|EEE89777.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357444703|ref|XP_003592629.1| Chaperone protein dnaJ [Medicago truncatula] gi|355481677|gb|AES62880.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449458757|ref|XP_004147113.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449513297|ref|XP_004164288.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein dnaJ 15-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 414 | ||||||
| TAIR|locus:2202334 | 410 | ARG1 "ALTERED RESPONSE TO GRAV | 0.983 | 0.992 | 0.777 | 8.2e-170 | |
| TAIR|locus:2032437 | 436 | ARL1 "ARG1-like 1" [Arabidopsi | 0.830 | 0.788 | 0.646 | 9.2e-124 | |
| TAIR|locus:2202725 | 414 | ARL2 "ARG1-like 2" [Arabidopsi | 0.828 | 0.828 | 0.559 | 3.7e-103 | |
| WB|WBGene00001034 | 395 | dnj-16 [Caenorhabditis elegans | 0.797 | 0.835 | 0.357 | 4.2e-47 | |
| TIGR_CMR|CHY_0416 | 381 | CHY_0416 "chaperone protein dn | 0.178 | 0.194 | 0.554 | 1.5e-16 | |
| WB|WBGene00001032 | 217 | dnj-14 [Caenorhabditis elegans | 0.195 | 0.373 | 0.477 | 1.1e-15 | |
| TIGR_CMR|NSE_0535 | 379 | NSE_0535 "chaperone protein Dn | 0.190 | 0.208 | 0.518 | 1.1e-15 | |
| TIGR_CMR|GSU_0034 | 373 | GSU_0034 "chaperone protein dn | 0.183 | 0.203 | 0.539 | 1.4e-15 | |
| UNIPROTKB|J9P8A9 | 269 | DNAJB11 "DnaJ homolog subfamil | 0.367 | 0.565 | 0.335 | 1.9e-15 | |
| UNIPROTKB|C9JUL4 | 172 | DNAJB4 "DnaJ homolog subfamily | 0.229 | 0.552 | 0.465 | 1.9e-15 |
| TAIR|locus:2202334 ARG1 "ALTERED RESPONSE TO GRAVITY 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1651 (586.2 bits), Expect = 8.2e-170, P = 8.2e-170
Identities = 321/413 (77%), Positives = 356/413 (86%)
Query: 1 MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
M + K+EGSSAP RRDPYEVLCVS+D++DQEIK+AYRKLALKYHPDKN +NP+A+ELFK
Sbjct: 1 MSAKKLEGSSAPANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFK 60
Query: 61 EVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
EVA+SYSILSDPEKRRHYDNAGFEA+DA+GMDMEIDLSNLGTVNTMFAALFSKLGVPIKT
Sbjct: 61 EVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
Query: 121 TISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQ 180
T+SANVLEEA+NGTVTVRPLPIGTSVSGKVEKQCAHFFGVTI++QQAE+G+VVRVTSTAQ
Sbjct: 121 TVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRVTSTAQ 180
Query: 181 SKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPES 240
SKFKLLYFEQD++GGYGLALQE+ EKTGKVTSAGMYFLHFQVYRMD+T+NA+A AKDPES
Sbjct: 181 SKFKLLYFEQDSSGGYGLALQEEREKTGKVTSAGMYFLHFQVYRMDTTVNALAAAKDPES 240
Query: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQ 300
AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTA+YTIEALCAK+YED ++KLK+IEAQ
Sbjct: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTIEALCAKTYEDTTEKLKEIEAQ 300
Query: 301 ILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHXXXXXXXXXXXXX 360
ILRKR ELR+FE EYRKALARFQE TNRY+QEKQ+VDELLKQRD IH
Sbjct: 301 ILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKTPSGNN 360
Query: 361 XXXXXXXXXXXXKVPGEDSKGESP-AEXXXXXXXXXXXXXXWFNLNLKGSDKK 412
K G++SKG+ A WFNLNLKGSDKK
Sbjct: 361 LSNGSSS-----KAQGDESKGDGDSAGEEGGTENRDKSKRKWFNLNLKGSDKK 408
|
|
| TAIR|locus:2032437 ARL1 "ARG1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202725 ARL2 "ARG1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001034 dnj-16 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0416 CHY_0416 "chaperone protein dnaJ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001032 dnj-14 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0535 NSE_0535 "chaperone protein DnaJ" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0034 GSU_0034 "chaperone protein dnaJ" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P8A9 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JUL4 DNAJB4 "DnaJ homolog subfamily B member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 414 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-29 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 9e-29 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 1e-27 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-25 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 7e-25 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 2e-24 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 4e-23 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 5e-23 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-22 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 2e-22 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 4e-22 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-21 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-21 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 2e-21 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 4e-21 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 1e-20 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-20 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 4e-20 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 4e-20 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 3e-19 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 3e-19 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 4e-19 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 8e-19 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 9e-19 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-18 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-18 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 2e-18 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 1e-17 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-17 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-17 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 3e-17 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 3e-16 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 1e-15 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 4e-13 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 1e-12 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 1e-10 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 4e-10 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 8e-09 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.002 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 108 bits (272), Expect = 2e-29
Identities = 42/63 (66%), Positives = 49/63 (77%)
Query: 17 DPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRR 76
D YE+L V RD+SD+EIK AYRKLALKYHPDKN +P A E FKE+ +Y +LSDPEKR
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60
Query: 77 HYD 79
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.97 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.96 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.77 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.74 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.73 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.73 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.69 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.68 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.67 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.61 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.6 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.59 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.56 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.55 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.54 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.54 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.39 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.38 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.35 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.34 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.33 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.33 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.3 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.15 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.12 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.04 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.0 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.95 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.88 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.78 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 98.75 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 98.61 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.59 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 98.37 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 98.29 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 98.22 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 98.21 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 98.21 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 98.19 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 98.18 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 98.17 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 98.16 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 98.14 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 98.14 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 98.13 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 98.12 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 98.12 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 98.09 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 98.08 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 98.08 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 98.07 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.06 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 98.06 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 98.05 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 98.04 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 98.01 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 97.99 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 97.96 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.88 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 97.88 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 97.75 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 97.72 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 97.63 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 97.56 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 97.51 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.2 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 96.94 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.14 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 95.95 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.99 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 94.46 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 94.21 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.02 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 86.82 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 86.34 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 85.67 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-57 Score=453.42 Aligned_cols=258 Identities=29% Similarity=0.405 Sum_probs=222.6
Q ss_pred CCCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCccccccccccccc
Q 015015 13 TIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMD 92 (414)
Q Consensus 13 ~~~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~~~~~~ 92 (414)
++.+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||||||||+||++||+||.++++++++.
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 45789999999999999999999999999999999999999999999999999999999999999999999998754433
Q ss_pred ccccccccC-ccchhhhhhhcc------------ccccceeccchhhHHHHhcCccc--------cccCCCcccc-CCcc
Q 015015 93 MEIDLSNLG-TVNTMFAALFSK------------LGVPIKTTISANVLEEALNGTVT--------VRPLPIGTSV-SGKV 150 (414)
Q Consensus 93 ~~~d~s~~g-d~~diF~~~Fg~------------~G~di~~~I~~~sLeEa~~G~v~--------~~~lc~Gtg~-~g~~ 150 (414)
.. .+++|+ +|+|+|++|||+ +|.|+.+.|.+ +|+||+.|+++ .|+.|.|+|+ +++.
T Consensus 81 g~-g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~i-sleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~ 158 (371)
T COG0484 81 GF-GFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEI-TLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTD 158 (371)
T ss_pred CC-CcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEe-EhhhhccCceeeEecceeeECCcCCCCCCCCCCC
Confidence 32 566666 599999999942 46689999999 99999999864 5889999987 6778
Q ss_pred ccccccccceeeeeeeccceeEEEEeeeccCcceeeecccCCCCccccee-ccCCCCCCceEeeeeEEEEEEEccCCCcc
Q 015015 151 EKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLAL-QEDSEKTGKVTSAGMYFLHFQVYRMDSTL 229 (414)
Q Consensus 151 ~k~C~~C~G~~i~~~~~~~G~v~~~~s~C~~kfkli~f~~~~CgG~G~~~-~~~s~C~G~g~~~~~~~l~v~Ip~G~~~g 229 (414)
+.+|++|+|.+.+.+....|++ +++.+| +.|+|+|.++ .+|+.|+|.|++.....|+|.||+|+.+|
T Consensus 159 ~~tC~tC~G~G~v~~~~~~g~~-~~~~~C-----------~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g 226 (371)
T COG0484 159 PKTCPTCNGSGQVRTVQRTGFF-SFQQTC-----------PTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDG 226 (371)
T ss_pred CCcCCCCCCcCeEEEEEeeeEE-EEEEEC-----------CCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccC
Confidence 9999999996665554444444 447899 9999999887 56888999999999999999999999999
Q ss_pred ceEEecCCCchhhhhccCCCCCCcce-e-ccCCCeeEEEeCCceeEecCccE-EEecCcchh
Q 015015 230 NAIAIAKDPESAFFKRLEGLQPCEVS-E-LKAGTHIFAVYGDNFFKTATYTI-EALCAKSYE 288 (414)
Q Consensus 230 ~~I~i~~~g~~g~~~rl~g~~~~~~~-~-i~~gd~~f~r~gdnl~~~~~isl-eal~g~s~~ 288 (414)
++|+++++++++. .|..++|++ . .+..|++|.|.|+||+..+.|++ +|+||..+.
T Consensus 227 ~~ir~~g~G~~g~----~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~ 284 (371)
T COG0484 227 DRIRLSGEGEAGP----NGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIE 284 (371)
T ss_pred CEEEEecCcccCC----CCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEE
Confidence 9999999997665 366678887 3 33568999999999999999996 999996543
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 414 | ||||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 9e-16 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 1e-14 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 4e-14 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 7e-14 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 9e-14 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 1e-13 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-13 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-13 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 9e-13 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 2e-12 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 3e-12 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 5e-12 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 5e-12 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 7e-12 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 1e-11 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 6e-10 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 8e-10 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 1e-08 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-08 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 6e-08 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 4e-07 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 1e-06 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 7e-05 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 1e-04 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-04 | ||
| 2qsa_A | 109 | Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 | 2e-04 |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
|
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 414 | |||
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 2e-32 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-31 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 4e-31 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 6e-31 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 7e-31 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 8e-31 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 1e-30 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-30 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 3e-30 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 7e-30 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 2e-29 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 4e-29 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 8e-29 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 8e-29 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-28 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 3e-28 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 5e-28 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 3e-27 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-25 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-24 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 3e-24 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 4e-24 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 7e-23 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 2e-21 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 6e-17 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 5e-13 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 5e-12 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 8e-12 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 1e-11 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 7e-11 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 2e-09 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 9e-07 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 6e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-05 |
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Score = 117 bits (294), Expect = 2e-32
Identities = 26/90 (28%), Positives = 39/90 (43%)
Query: 1 MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
+ R Y++L V ++ +IK AY + YHPD+N + EAAE F
Sbjct: 2 SSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFT 61
Query: 61 EVAYSYSILSDPEKRRHYDNAGFEAIDAEG 90
++ +Y +L RR YD D G
Sbjct: 62 RISQAYVVLGSATLRRKYDRGLLSDEDLRG 91
|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.9 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.87 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.83 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.83 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.82 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.81 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.81 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.81 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.81 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.81 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.81 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.8 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.79 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.78 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.78 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.77 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.73 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.72 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.69 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.68 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.65 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.65 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.64 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.62 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.62 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.61 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.6 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.59 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.59 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.58 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.55 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.52 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.51 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 99.42 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.21 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.14 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 99.01 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.93 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.43 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 98.36 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.91 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 95.66 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 95.07 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 94.89 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 94.8 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 93.82 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 92.95 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 92.72 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 92.17 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 89.92 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 89.13 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 89.06 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 87.91 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 85.39 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 84.71 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.2e-35 Score=289.52 Aligned_cols=210 Identities=23% Similarity=0.309 Sum_probs=80.9
Q ss_pred CCCCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCcccccccccccc
Q 015015 12 PTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGM 91 (414)
Q Consensus 12 ~~~~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~~~~~ 91 (414)
.+..+|||+||||+++||.+|||+|||+||++||||+++ ++.|.++|++|++||++|+||.+|+.||+++...... +.
T Consensus 24 ~m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~-~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~-~~ 101 (329)
T 3lz8_A 24 AMELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDP-GF 101 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred cccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCC-ChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCC-Cc
Confidence 345689999999999999999999999999999999998 5678899999999999999999999999985432111 11
Q ss_pred c--c---cccccccCccchhhhhhhcc-----------ccccceeccchhhHHHHhcCccccccCCCccccCCccccccc
Q 015015 92 D--M---EIDLSNLGTVNTMFAALFSK-----------LGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCA 155 (414)
Q Consensus 92 ~--~---~~d~s~~gd~~diF~~~Fg~-----------~G~di~~~I~~~sLeEa~~G~v~~~~lc~Gtg~~g~~~k~C~ 155 (414)
. . ..+++ .++|.++|++|||+ .|.|+...|.+ +|+|+|+|+.+...+.
T Consensus 102 ~~~~~~~~~~f~-~~~f~diF~~~Fg~~g~~~~~~~~~~g~Dl~~~l~v-sleea~~G~~k~i~i~-------------- 165 (329)
T 3lz8_A 102 GRQRQTHEQSYS-QQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIEVAV-FLEETLAEQTRTISYN-------------- 165 (329)
T ss_dssp ------------------------------------CCCCCCEEEEECC-CTTGGGSCEEEEEEEE--------------
T ss_pred ccccccccCCcC-CCchhhhhHhhhcCcCCCCCCCCcCCCCCEEEEEec-chhhhhhccceEEEEE--------------
Confidence 0 0 01111 13578899999974 36689999999 9999999976422110
Q ss_pred cccceeeeeeeccceeEEEEeeeccCcceeeecccCCCCcccceeccCCCCCCceEeeeeEEEEEEEccCCCccceEEec
Q 015015 156 HFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIA 235 (414)
Q Consensus 156 ~C~G~~i~~~~~~~G~v~~~~s~C~~kfkli~f~~~~CgG~G~~~~~~s~C~G~g~~~~~~~l~v~Ip~G~~~g~~I~i~ 235 (414)
. +.|.|.|.+ ++.....|+|.||+|+.+|++|+++
T Consensus 166 -----------------------~-----------~v~~g~G~v-----------~~~~~~~l~V~IP~Gv~~G~~Irl~ 200 (329)
T 3lz8_A 166 -----------------------L-----------PVYNVFGMI-----------ESETPKTLNVKIPAGVVDGQRIRLK 200 (329)
T ss_dssp -----------------------E-----------EECCSCC-C-----------CEEEEEEEEEEECTTCCTTCEEEES
T ss_pred -----------------------E-----------EeecCCeEE-----------EEecceEEEEeCCCCCCCCCEEEEc
Confidence 0 111222322 2334568999999999999999999
Q ss_pred CCCchhhhhccCCCCCCcce-ecc-CCCeeEEEeCCceeEecCccE-EEecCcchh
Q 015015 236 KDPESAFFKRLEGLQPCEVS-ELK-AGTHIFAVYGDNFFKTATYTI-EALCAKSYE 288 (414)
Q Consensus 236 ~~g~~g~~~rl~g~~~~~~~-~i~-~gd~~f~r~gdnl~~~~~isl-eal~g~s~~ 288 (414)
++|+++. +|..++|++ .+. ..|++|.|+|+||++++.|++ +|+||.+++
T Consensus 201 G~G~~g~----~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~ 252 (329)
T 3lz8_A 201 GQGTPGE----NGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVT 252 (329)
T ss_dssp SCSCCC-------CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEE
T ss_pred ccccCCC----CCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEE
Confidence 9995543 356688887 444 459999999999999999998 999997753
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 414 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 4e-18 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-17 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 5e-17 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 3e-15 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 1e-14 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-13 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 1e-12 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-10 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 76.2 bits (187), Expect = 4e-18
Identities = 32/73 (43%), Positives = 51/73 (69%)
Query: 15 RRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEK 74
++D YE+L VS+ + ++EI+ AY++LA+KYHPD+N + EA FKE+ +Y +L+D +K
Sbjct: 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQK 61
Query: 75 RRHYDNAGFEAID 87
R YD G A +
Sbjct: 62 RAAYDQYGHAAFE 74
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 414 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.88 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.78 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.75 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.62 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.61 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.59 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.58 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 98.33 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.15 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 98.11 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.56 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 95.0 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 90.97 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 90.06 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 89.68 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 80.87 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 80.74 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.88 E-value=7.6e-24 Score=165.01 Aligned_cols=73 Identities=44% Similarity=0.821 Sum_probs=69.0
Q ss_pred CCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCcccccccc
Q 015015 15 RRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAID 87 (414)
Q Consensus 15 ~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~ 87 (414)
.+|||+||||+++||.++||+|||+|+++||||++++++.+.+.|..|++||+||+||.+|+.||++|..+++
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e 74 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE 74 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence 4799999999999999999999999999999999998888999999999999999999999999999977653
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|