Citrus Sinensis ID: 015023


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV
ccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHcccEEEEEcccccEEcccccccccccccCEECcccccccEEEEEccccccccEEEEcccccccccEEEEcccccccccEEEccEEEEccEEccccccccHHHHcccccccccccccccccccEEECccccEEEEEEcccccEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
******************YEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDA***DMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQE****TGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFT**************************************************FNLNLKG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chaperone protein dnaJ 15 Have a continuous role in plant development probably in the structural organization of compartments (By similarity). Seems to be involved in early gravitropic signal transduction within the gravity-perceiving cells (statocytes), where it influences pH changes and auxin distribution. Probably affects the localization and/or activity of auxin efflux carrier components (PIN proteins) or other proteins involved in lateral auxin transport.confidentQ9ZSY2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 117-141,179,191-199,211-288
View the alignment between query and template
View the model in PyMOL
Template: 1NLT, chain A
Confidence level:confident
Coverage over the Query: 114-179,191-287
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 288-345
View the alignment between query and template
View the model in PyMOL