Citrus Sinensis ID: 015023

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV
ccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHcccEEEEEcccccEEcccccccccccccEEEEcccccccEEEEEccccccccEEEEcccccccccEEEEcccccccccEEEccEEEEccEEccccccccHHHHcccccccccccccccccccEEEEccccEEEEEEcccccEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
cccccccccccHHHcccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHEEccEEEEEHcccccEEEEEEEcccccccccccccccccccccEccccEEEEEEEEEEEEEEcccccEEEEEccccccccEEEccEEEEcccEEcccccccHHHHcccccHHHHHHHccccccEEEEcccccEEEEEEccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccc
mgsnkmegssaptirrdpyevlcvsrdssdQEIKTAYRKLALkyhpdknvsnpeAAELFKEVAYSYsilsdpekrrhydnagfeaidaegmdmeidlsnlgtVNTMFAALFSKLGVPIKTTISANVLEEALngtvtvrplpigtsvsgkvEKQCAHFFGvtindqqaeaGIVVRVTSTAQSKFKLLYFEqdtnggyglalqedsektgkvtsAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKrleglqpcevselkaGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLStssvsgnnlsngssskvpgedskgespaedgssdgkdksakKKWFNlnlkgsdkkav
mgsnkmegssaptirrdpyevlcvsrdssdqEIKTAYRKLAlkyhpdknvsNPEAAELFKEVAYSYSilsdpekrrhyDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKsyednsqklkDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFtvtktlstssvsgnnlsngssskvpgedskgespaedgssdgkdksakkkwfnlnlkgsdkkav
MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHssftvtktlstssvsgnnlsngsssKVPGEDSKGESPAEdgssdgkdksakkkWFNLNLKGSDKKAV
*******************EVLCV**********TAYRKLALKYH**********AELFKEVAYSYSILSD***RRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQE****TGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDN**KLKDIEAQILRKRKELREFEIEYRKALARF********************************************************************************************
******************YEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFE************LSNLGTVNTMFAA******************EEALNGTVTVRPLPIGTSVSGKVEKQCAHFF********************************************************MYFLHFQVYRMDSTL*************FKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFT**************************************************FNLNLKG******
************TIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKT*****************************************AKKKWFNLNL********
**************RRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDA***DMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTV*********************************************KKKWFNLNLKGS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDAIHSSFTVTKTLSTSSVSGNNLSNGSSSKVPGEDSKGESPAEDGSSDGKDKSAKKKWFNLNLKGSDKKAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q9ZSY2410 Chaperone protein dnaJ 15 yes no 0.980 0.990 0.830 0.0
Q8VXV4436 Chaperone protein dnaJ 16 no no 0.956 0.908 0.572 1e-140
Q6XL73414 Chaperone protein dnaJ 39 no no 0.971 0.971 0.506 1e-116
Q1H3B9373 Chaperone protein DnaJ OS yes no 0.176 0.195 0.575 7e-18
Q3MG81376 Chaperone protein DnaJ OS yes no 0.229 0.252 0.463 7e-18
Q8YUA5376 Chaperone protein DnaJ OS yes no 0.229 0.252 0.463 8e-18
Q9UXR9387 Chaperone protein DnaJ OS N/A no 0.219 0.235 0.489 9e-18
Q3AF07381 Chaperone protein DnaJ OS yes no 0.178 0.194 0.554 2e-17
Q8EUM4388 Chaperone protein DnaJ OS yes no 0.178 0.190 0.533 3e-17
Q9ZFC5371 Chaperone protein DnaJ OS N/A no 0.176 0.196 0.561 3e-17
>sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 Back     alignment and function desciption
 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/414 (83%), Positives = 386/414 (93%), Gaps = 8/414 (1%)

Query: 1   MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
           M + K+EGSSAP  RRDPYEVLCVS+D++DQEIK+AYRKLALKYHPDKN +NP+A+ELFK
Sbjct: 1   MSAKKLEGSSAPANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFK 60

Query: 61  EVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
           EVA+SYSILSDPEKRRHYDNAGFEA+DA+GMDMEIDLSNLGTVNTMFAALFSKLGVPIKT
Sbjct: 61  EVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120

Query: 121 TISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQ 180
           T+SANVLEEA+NGTVTVRPLPIGTSVSGKVEKQCAHFFGVTI++QQAE+G+VVRVTSTAQ
Sbjct: 121 TVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRVTSTAQ 180

Query: 181 SKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPES 240
           SKFKLLYFEQD++GGYGLALQE+ EKTGKVTSAGMYFLHFQVYRMD+T+NA+A AKDPES
Sbjct: 181 SKFKLLYFEQDSSGGYGLALQEEREKTGKVTSAGMYFLHFQVYRMDTTVNALAAAKDPES 240

Query: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQ 300
           AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTA+YTIEALCAK+YED ++KLK+IEAQ
Sbjct: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTIEALCAKTYEDTTEKLKEIEAQ 300

Query: 301 ILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSS 360
           ILRKR ELR+FE EYRKALARFQE TNRY+QEKQ+VDELLKQRD IHS+F+V KT     
Sbjct: 301 ILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKT----- 355

Query: 361 VSGNNLSNGSSSKVPGEDSK--GESPAEDGSSDGKDKSAKKKWFNLNLKGSDKK 412
            SGNNLSNGSSSK  G++SK  G+S  E+G ++ +DKS K+KWFNLNLKGSDKK
Sbjct: 356 PSGNNLSNGSSSKAQGDESKGDGDSAGEEGGTENRDKS-KRKWFNLNLKGSDKK 408
Have a continuous role in plant development probably in the structural organization of compartments (By similarity). Seems to be involved in early gravitropic signal transduction within the gravity-perceiving cells (statocytes), where it influences pH changes and auxin distribution. Probably affects the localization and/or activity of auxin efflux carrier components (PIN proteins) or other proteins involved in lateral auxin transport.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 Back     alignment and function description
>sp|Q6XL73|DNJ39_ARATH Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2 Back     alignment and function description
>sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
297841555410 hypothetical protein ARALYDRAFT_894602 [ 0.980 0.990 0.838 0.0
15221381410 chaperone protein dnaJ 15 [Arabidopsis t 0.980 0.990 0.830 0.0
225424031415 PREDICTED: chaperone protein dnaJ 15 [Vi 0.995 0.992 0.857 0.0
110737915410 ARG1 protein [Arabidopsis thaliana] 0.980 0.990 0.828 0.0
224108448406 predicted protein [Populus trichocarpa] 0.978 0.997 0.866 0.0
449434604409 PREDICTED: chaperone protein dnaJ 15-lik 0.980 0.992 0.828 0.0
224101759407 predicted protein [Populus trichocarpa] 0.978 0.995 0.826 0.0
357444703414 Chaperone protein dnaJ [Medicago truncat 0.987 0.987 0.859 0.0
449458757413 PREDICTED: chaperone protein dnaJ 15-lik 0.980 0.983 0.812 0.0
449513297413 PREDICTED: LOW QUALITY PROTEIN: chaperon 0.980 0.983 0.812 0.0
>gi|297841555|ref|XP_002888659.1| hypothetical protein ARALYDRAFT_894602 [Arabidopsis lyrata subsp. lyrata] gi|297334500|gb|EFH64918.1| hypothetical protein ARALYDRAFT_894602 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/414 (83%), Positives = 387/414 (93%), Gaps = 8/414 (1%)

Query: 1   MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
           M + K+EGSSAP  RRDPYEVLCVS+D++DQEIK+AYRKLALKYHPDKN +NP+A+ELFK
Sbjct: 1   MSAKKLEGSSAPANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFK 60

Query: 61  EVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
           EVA+SYSILSDPEKRRHYDNAGFEA+DA+GMDMEIDLSNLGTVNTMFAALFSKLGVPIKT
Sbjct: 61  EVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120

Query: 121 TISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQ 180
           T+SANVLEEA+NGTVTVRPLPIGTSVSGKVEKQCAHFFGVTI++QQAE+G+VVRVTSTAQ
Sbjct: 121 TVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRVTSTAQ 180

Query: 181 SKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPES 240
           SKFKLLYFEQD++GGYGLALQE+SEKTGKVTSAGMYFLHFQVYRMDST+NA+A AKDPES
Sbjct: 181 SKFKLLYFEQDSSGGYGLALQEESEKTGKVTSAGMYFLHFQVYRMDSTVNALAAAKDPES 240

Query: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQ 300
           AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTA+YTIEALCAK+YED ++KLK+IEAQ
Sbjct: 241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTIEALCAKTYEDTTEKLKEIEAQ 300

Query: 301 ILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHSSFTVTKTLSTSS 360
           ILRKR ELR+FE EYRKALARFQE TNRY+QEKQ+VDELLKQRD IHS+F+V KT     
Sbjct: 301 ILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKT----- 355

Query: 361 VSGNNLSNGSSSKVPGEDSK--GESPAEDGSSDGKDKSAKKKWFNLNLKGSDKK 412
            SGNNLSNGSSSK  GE+SK  G+S  E+G ++ +DKS K+KWFNLNLKGSDKK
Sbjct: 356 PSGNNLSNGSSSKAQGEESKGDGDSAGEEGGTESRDKS-KRKWFNLNLKGSDKK 408

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|15221381|ref|NP_177004.1| chaperone protein dnaJ 15 [Arabidopsis thaliana] gi|67462423|sp|Q9ZSY2.1|DNJ15_ARATH RecName: Full=Chaperone protein dnaJ 15; Short=AtDjB15; Short=AtJ15; AltName: Full=Protein ALTERED RESPONSE TO GRAVITY; Short=AtARG1 gi|6714354|gb|AAF26045.1|AC015986_8 ARG1 protein (Altered Response to Gravity); 32591-35072 [Arabidopsis thaliana] gi|4249662|gb|AAD13758.1| Altered Response to Gravity [Arabidopsis thaliana] gi|98960981|gb|ABF58974.1| At1g68370 [Arabidopsis thaliana] gi|332196665|gb|AEE34786.1| chaperone protein dnaJ 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225424031|ref|XP_002283449.1| PREDICTED: chaperone protein dnaJ 15 [Vitis vinifera] gi|147769068|emb|CAN72503.1| hypothetical protein VITISV_027277 [Vitis vinifera] gi|297737795|emb|CBI26996.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|110737915|dbj|BAF00895.1| ARG1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224108448|ref|XP_002314850.1| predicted protein [Populus trichocarpa] gi|222863890|gb|EEF01021.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434604|ref|XP_004135086.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] gi|449493448|ref|XP_004159293.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224101759|ref|XP_002312410.1| predicted protein [Populus trichocarpa] gi|222852230|gb|EEE89777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357444703|ref|XP_003592629.1| Chaperone protein dnaJ [Medicago truncatula] gi|355481677|gb|AES62880.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|449458757|ref|XP_004147113.1| PREDICTED: chaperone protein dnaJ 15-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449513297|ref|XP_004164288.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein dnaJ 15-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2202334410 ARG1 "ALTERED RESPONSE TO GRAV 0.983 0.992 0.777 8.2e-170
TAIR|locus:2032437436 ARL1 "ARG1-like 1" [Arabidopsi 0.830 0.788 0.646 9.2e-124
TAIR|locus:2202725414 ARL2 "ARG1-like 2" [Arabidopsi 0.828 0.828 0.559 3.7e-103
WB|WBGene00001034395 dnj-16 [Caenorhabditis elegans 0.797 0.835 0.357 4.2e-47
TIGR_CMR|CHY_0416381 CHY_0416 "chaperone protein dn 0.178 0.194 0.554 1.5e-16
WB|WBGene00001032217 dnj-14 [Caenorhabditis elegans 0.195 0.373 0.477 1.1e-15
TIGR_CMR|NSE_0535379 NSE_0535 "chaperone protein Dn 0.190 0.208 0.518 1.1e-15
TIGR_CMR|GSU_0034373 GSU_0034 "chaperone protein dn 0.183 0.203 0.539 1.4e-15
UNIPROTKB|J9P8A9269 DNAJB11 "DnaJ homolog subfamil 0.367 0.565 0.335 1.9e-15
UNIPROTKB|C9JUL4172 DNAJB4 "DnaJ homolog subfamily 0.229 0.552 0.465 1.9e-15
TAIR|locus:2202334 ARG1 "ALTERED RESPONSE TO GRAVITY 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1651 (586.2 bits), Expect = 8.2e-170, P = 8.2e-170
 Identities = 321/413 (77%), Positives = 356/413 (86%)

Query:     1 MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
             M + K+EGSSAP  RRDPYEVLCVS+D++DQEIK+AYRKLALKYHPDKN +NP+A+ELFK
Sbjct:     1 MSAKKLEGSSAPANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFK 60

Query:    61 EVAYSYSILSDPEKRRHYDNAGFEAIDAEGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120
             EVA+SYSILSDPEKRRHYDNAGFEA+DA+GMDMEIDLSNLGTVNTMFAALFSKLGVPIKT
Sbjct:    61 EVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVPIKT 120

Query:   121 TISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTINDQQAEAGIVVRVTSTAQ 180
             T+SANVLEEA+NGTVTVRPLPIGTSVSGKVEKQCAHFFGVTI++QQAE+G+VVRVTSTAQ
Sbjct:   121 TVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRVTSTAQ 180

Query:   181 SKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKDPES 240
             SKFKLLYFEQD++GGYGLALQE+ EKTGKVTSAGMYFLHFQVYRMD+T+NA+A AKDPES
Sbjct:   181 SKFKLLYFEQDSSGGYGLALQEEREKTGKVTSAGMYFLHFQVYRMDTTVNALAAAKDPES 240

Query:   241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTATYTIEALCAKSYEDNSQKLKDIEAQ 300
             AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTA+YTIEALCAK+YED ++KLK+IEAQ
Sbjct:   241 AFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTIEALCAKTYEDTTEKLKEIEAQ 300

Query:   301 ILRKRKELREFEIEYRKALARFQEATNRYSQEKQSVDELLKQRDAIHXXXXXXXXXXXXX 360
             ILRKR ELR+FE EYRKALARFQE TNRY+QEKQ+VDELLKQRD IH             
Sbjct:   301 ILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKTPSGNN 360

Query:   361 XXXXXXXXXXXXKVPGEDSKGESP-AEXXXXXXXXXXXXXXWFNLNLKGSDKK 412
                         K  G++SKG+   A               WFNLNLKGSDKK
Sbjct:   361 LSNGSSS-----KAQGDESKGDGDSAGEEGGTENRDKSKRKWFNLNLKGSDKK 408
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0008092 "cytoskeletal protein binding" evidence=TAS
GO:0009638 "phototropism" evidence=IMP
GO:0009958 "positive gravitropism" evidence=IMP
TAIR|locus:2032437 ARL1 "ARG1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202725 ARL2 "ARG1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00001034 dnj-16 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0416 CHY_0416 "chaperone protein dnaJ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
WB|WBGene00001032 dnj-14 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0535 NSE_0535 "chaperone protein DnaJ" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0034 GSU_0034 "chaperone protein dnaJ" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8A9 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JUL4 DNAJB4 "DnaJ homolog subfamily B member 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZSY2DNJ15_ARATHNo assigned EC number0.83090.98060.9902yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-29
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 9e-29
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-27
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-25
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 7e-25
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-24
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-23
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 5e-23
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-22
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-22
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 4e-22
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-21
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-21
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 4e-21
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-20
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-20
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-20
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-20
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-19
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-19
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-19
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 8e-19
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 9e-19
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-18
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 1e-18
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-18
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-17
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-17
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-17
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-17
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-16
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-15
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-13
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-12
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-10
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 4e-10
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 8e-09
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 3e-04
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 4e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.002
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score =  108 bits (272), Expect = 2e-29
 Identities = 42/63 (66%), Positives = 49/63 (77%)

Query: 17 DPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRR 76
          D YE+L V RD+SD+EIK AYRKLALKYHPDKN  +P A E FKE+  +Y +LSDPEKR 
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 77 HYD 79
           YD
Sbjct: 61 IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PTZ00037421 DnaJ_C chaperone protein; Provisional 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
PRK14299291 chaperone protein DnaJ; Provisional 99.97
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.97
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.97
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.73
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.68
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.62
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
PHA03102153 Small T antigen; Reviewed 99.6
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.59
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.56
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.56
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.52
PRK05014171 hscB co-chaperone HscB; Provisional 99.38
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PRK01356166 hscB co-chaperone HscB; Provisional 99.34
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.33
PRK03578176 hscB co-chaperone HscB; Provisional 99.33
PRK00294173 hscB co-chaperone HscB; Provisional 99.31
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.3
PTZ00100116 DnaJ chaperone protein; Provisional 99.14
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.11
PHA02624 647 large T antigen; Provisional 99.04
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.02
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.97
PRK01773173 hscB co-chaperone HscB; Provisional 98.84
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.76
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 98.76
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 98.62
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.6
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 98.38
PRK14284391 chaperone protein DnaJ; Provisional 98.27
PRK14279392 chaperone protein DnaJ; Provisional 98.2
PRK14298377 chaperone protein DnaJ; Provisional 98.19
PRK14296372 chaperone protein DnaJ; Provisional 98.19
PRK14278378 chaperone protein DnaJ; Provisional 98.18
PRK14288369 chaperone protein DnaJ; Provisional 98.16
PRK14285365 chaperone protein DnaJ; Provisional 98.15
PRK14282369 chaperone protein DnaJ; Provisional 98.15
PRK14281397 chaperone protein DnaJ; Provisional 98.12
PRK14287371 chaperone protein DnaJ; Provisional 98.12
PRK14300372 chaperone protein DnaJ; Provisional 98.11
PRK14290365 chaperone protein DnaJ; Provisional 98.1
PRK14295389 chaperone protein DnaJ; Provisional 98.1
PRK14280376 chaperone protein DnaJ; Provisional 98.07
PRK14294366 chaperone protein DnaJ; Provisional 98.06
PRK14291382 chaperone protein DnaJ; Provisional 98.06
PRK14276380 chaperone protein DnaJ; Provisional 98.05
PTZ00037421 DnaJ_C chaperone protein; Provisional 98.03
PRK14286372 chaperone protein DnaJ; Provisional 98.03
PRK14277386 chaperone protein DnaJ; Provisional 98.02
PRK10767371 chaperone protein DnaJ; Provisional 98.0
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.98
PRK14297380 chaperone protein DnaJ; Provisional 97.97
PRK14301373 chaperone protein DnaJ; Provisional 97.95
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.87
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 97.85
PRK14289386 chaperone protein DnaJ; Provisional 97.73
PRK14283378 chaperone protein DnaJ; Provisional 97.69
PLN03165111 chaperone protein dnaJ-related; Provisional 97.65
PRK14293374 chaperone protein DnaJ; Provisional 97.53
PRK14292371 chaperone protein DnaJ; Provisional 97.48
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.1
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 96.94
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 96.11
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 95.58
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.03
KOG2813406 consensus Predicted molecular chaperone, contains 94.67
KOG0431453 consensus Auxilin-like protein and related protein 94.45
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 93.17
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 86.69
PRK10266306 curved DNA-binding protein CbpA; Provisional 86.51
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 82.97
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-58  Score=456.58  Aligned_cols=258  Identities=29%  Similarity=0.405  Sum_probs=222.7

Q ss_pred             CCCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCccccccccccccc
Q 015023           13 TIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAEGMD   92 (414)
Q Consensus        13 ~~~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~~~g~~   92 (414)
                      ++.+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|++||||||||+||++||+||.+++++++++
T Consensus         1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g   80 (371)
T COG0484           1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG   80 (371)
T ss_pred             CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999998855433


Q ss_pred             ccccccccc-cchhhhhhhhcc------------cCccceeccchhhHHHHhcCccc--------cccCCCcccc-CCcc
Q 015023           93 MEIDLSNLG-TVNTMFAALFSK------------LGVPIKTTISANVLEEALNGTVT--------VRPLPIGTSV-SGKV  150 (414)
Q Consensus        93 ~~~d~s~~g-d~~diF~~~Fg~------------~G~di~~~I~~~sLeEa~~G~vk--------~~~lc~Gtg~-~g~~  150 (414)
                      .. ++++|+ +|+|||++|||+            .|.|+.+.|.+ +|+||+.|+++        .|+.|.|+|+ +++.
T Consensus        81 g~-g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~i-sleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~  158 (371)
T COG0484          81 GF-GFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEI-TLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTD  158 (371)
T ss_pred             CC-CcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEe-EhhhhccCceeeEecceeeECCcCCCCCCCCCCC
Confidence            32 566666 599999999942            46689999999 99999999864        5889999986 6778


Q ss_pred             ccccccccceeeeeeeccceeEEEEeeeccCcceeeecccCCCCcccccc-ccCCCCCCceEeeeeEEEEEEEccCCCcc
Q 015023          151 EKQCAHFFGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLAL-QEDSEKTGKVTSAGMYFLHFQVYRMDSTL  229 (414)
Q Consensus       151 ~k~C~~C~G~~i~~~~~~~G~v~~~~s~C~~kfkli~f~~~~CgG~G~~i-~~~s~C~G~g~~~~~~~l~v~Vp~G~~~g  229 (414)
                      +.+|++|+|.+.+.+....|++ +++.+|           +.|+|+|.++ .+|+.|+|.|++.....|+|.||+|+.+|
T Consensus       159 ~~tC~tC~G~G~v~~~~~~g~~-~~~~~C-----------~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g  226 (371)
T COG0484         159 PKTCPTCNGSGQVRTVQRTGFF-SFQQTC-----------PTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDG  226 (371)
T ss_pred             CCcCCCCCCcCeEEEEEeeeEE-EEEEEC-----------CCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccC
Confidence            9999999996665554444444 447899           9999999877 56888999999999999999999999999


Q ss_pred             ceEEecCCCchhhhhccCCCCCCcce-e-ccCCCeeEEEeCCceeEecCccE-EEecCcchh
Q 015023          230 NAIAIAKDPESAFFKRLEGLQPCEVS-E-LKAGTHIFAVYGDNFFKTATYTI-EALCAKSYE  288 (414)
Q Consensus       230 ~~I~i~~~g~~g~~~rl~g~~~~~~~-~-i~~gd~~f~r~Gdnl~~~~~isl-eal~g~s~~  288 (414)
                      ++|+++++++++.    .|..++|++ . .+..|++|.|.|+|||..+.|++ +|+||..+.
T Consensus       227 ~~ir~~g~G~~g~----~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~  284 (371)
T COG0484         227 DRIRLSGEGEAGP----NGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIE  284 (371)
T ss_pred             CEEEEecCcccCC----CCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEE
Confidence            9999999996665    366678887 3 33568899999999999999996 999996543

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 9e-16
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-14
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 4e-14
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-14
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 9e-14
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-13
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-13
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-13
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 9e-13
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-12
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 5e-12
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-12
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 7e-12
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-11
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 6e-10
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 8e-10
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-08
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-08
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 6e-08
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 1e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 7e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 1e-04
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 2e-04
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 2e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 1/66 (1%)
Query: 17 DPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRR 76
          D YE+L VSR +SD+++K AYR+LALK+HPDKN + P A E FK +  +Y++LS+PEKR+
Sbjct: 8  DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHA-PGATEAFKAIGTAYAVLSNPEKRK 66
Query: 77 HYDNAG 82
           YD  G
Sbjct: 67 QYDQFG 72
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-32
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-31
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 4e-31
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 6e-31
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 7e-31
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 8e-31
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-30
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-30
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-30
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-30
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-29
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-29
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 8e-29
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 8e-29
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-28
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-28
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 5e-28
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-27
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-25
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-24
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 3e-24
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-24
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 7e-23
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-17
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-13
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-12
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-11
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 7e-11
2guz_A71 Mitochondrial import inner membrane translocase su 2e-09
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 9e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 6e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-05
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  117 bits (294), Expect = 2e-32
 Identities = 26/90 (28%), Positives = 39/90 (43%)

Query: 1  MGSNKMEGSSAPTIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFK 60
             +          R   Y++L V   ++  +IK AY +    YHPD+N  + EAAE F 
Sbjct: 2  SSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFT 61

Query: 61 EVAYSYSILSDPEKRRHYDNAGFEAIDAEG 90
           ++ +Y +L     RR YD       D  G
Sbjct: 62 RISQAYVVLGSATLRRKYDRGLLSDEDLRG 91
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.9
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.87
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.83
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.83
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.82
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.82
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.81
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.81
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.81
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.81
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.8
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.79
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.79
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.78
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.78
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.74
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.72
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.69
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.68
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.66
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.64
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.64
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.62
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.62
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.61
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.6
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.59
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.59
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.55
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.52
2guz_A71 Mitochondrial import inner membrane translocase su 99.51
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 99.42
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 99.2
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.15
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 99.02
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.93
2guz_B65 Mitochondrial import inner membrane translocase su 98.39
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 98.34
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.93
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 95.58
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 94.93
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 94.76
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 94.61
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 94.07
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 92.98
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 92.69
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 92.13
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 90.53
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 89.7
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 89.07
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 87.87
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 85.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 83.87
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=5e-35  Score=291.13  Aligned_cols=210  Identities=22%  Similarity=0.293  Sum_probs=81.0

Q ss_pred             CCCCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCcccccccccc---
Q 015023           13 TIRRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAIDAE---   89 (414)
Q Consensus        13 ~~~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~~~---   89 (414)
                      ...+|||+||||+++||.+|||+|||+||++||||+++ ++.|.++|++|++||++|+||.+|+.||+++......+   
T Consensus        25 m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~-~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~  103 (329)
T 3lz8_A           25 MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR  103 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCC-ChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccc
Confidence            34579999999999999999999999999999999998 56788999999999999999999999999854321110   


Q ss_pred             cccc-cccccccccchhhhhhhhcc-----------cCccceeccchhhHHHHhcCccccccCCCccccCCccccccccc
Q 015023           90 GMDM-EIDLSNLGTVNTMFAALFSK-----------LGVPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQCAHF  157 (414)
Q Consensus        90 g~~~-~~d~s~~gd~~diF~~~Fg~-----------~G~di~~~I~~~sLeEa~~G~vk~~~lc~Gtg~~g~~~k~C~~C  157 (414)
                      ++.. ..+++ .++|.++|++|||+           .|.|+...|.+ +|+|+|+|+.+...+.                
T Consensus       104 ~~~~~~~~f~-~~~f~diF~~~Fg~~g~~~~~~~~~~g~Dl~~~l~v-sleea~~G~~k~i~i~----------------  165 (329)
T 3lz8_A          104 QRQTHEQSYS-QQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIEVAV-FLEETLAEQTRTISYN----------------  165 (329)
T ss_dssp             ----------------------------------CCCCCCEEEEECC-CTTGGGSCEEEEEEEE----------------
T ss_pred             ccccccCCcC-CCchhhhhHhhhcCcCCCCCCCCcCCCCCEEEEEec-chhhhhhccceEEEEE----------------
Confidence            0000 01111 13578899999974           36689999999 9999999986432110                


Q ss_pred             cceeeeeeeccceeEEEEeeeccCcceeeecccCCCCccccccccCCCCCCceEeeeeEEEEEEEccCCCccceEEecCC
Q 015023          158 FGVTINDQQAEAGIVVRVTSTAQSKFKLLYFEQDTNGGYGLALQEDSEKTGKVTSAGMYFLHFQVYRMDSTLNAIAIAKD  237 (414)
Q Consensus       158 ~G~~i~~~~~~~G~v~~~~s~C~~kfkli~f~~~~CgG~G~~i~~~s~C~G~g~~~~~~~l~v~Vp~G~~~g~~I~i~~~  237 (414)
                                           .           +.|.|.|.+           ++.....|+|.||+|+.+|++|+++++
T Consensus       166 ---------------------~-----------~v~~g~G~v-----------~~~~~~~l~V~IP~Gv~~G~~Irl~G~  202 (329)
T 3lz8_A          166 ---------------------L-----------PVYNVFGMI-----------ESETPKTLNVKIPAGVVDGQRIRLKGQ  202 (329)
T ss_dssp             ---------------------E-----------EECCSCC-C-----------CEEEEEEEEEEECTTCCTTCEEEESSC
T ss_pred             ---------------------E-----------EeecCCeEE-----------EEecceEEEEeCCCCCCCCCEEEEccc
Confidence                                 0           111222322           233456899999999999999999999


Q ss_pred             CchhhhhccCCCCCCcce-ecc-CCCeeEEEeCCceeEecCccE-EEecCcchh
Q 015023          238 PESAFFKRLEGLQPCEVS-ELK-AGTHIFAVYGDNFFKTATYTI-EALCAKSYE  288 (414)
Q Consensus       238 g~~g~~~rl~g~~~~~~~-~i~-~gd~~f~r~Gdnl~~~~~isl-eal~g~s~~  288 (414)
                      |+++.    ++..++|++ .+. ..|++|.|+|+||++++.|++ +|+||.++.
T Consensus       203 G~~g~----~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~  252 (329)
T 3lz8_A          203 GTPGE----NGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVT  252 (329)
T ss_dssp             SCCC-------CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEE
T ss_pred             ccCCC----CCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEE
Confidence            95543    356688888 444 459999999999999999998 999997753
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 414
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-18
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-17
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 5e-17
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-15
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-13
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-10
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 76.2 bits (187), Expect = 4e-18
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 15 RRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEK 74
          ++D YE+L VS+ + ++EI+ AY++LA+KYHPD+N  + EA   FKE+  +Y +L+D +K
Sbjct: 2  KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQK 61

Query: 75 RRHYDNAGFEAID 87
          R  YD  G  A +
Sbjct: 62 RAAYDQYGHAAFE 74
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.88
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.79
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.75
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.62
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.61
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.57
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 98.34
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.17
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 98.11
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 97.56
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 94.96
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 90.57
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 90.08
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 89.59
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 81.3
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 80.99
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=5.1e-24  Score=166.08  Aligned_cols=73  Identities=44%  Similarity=0.821  Sum_probs=69.1

Q ss_pred             CCCCccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHhhhhccccCcccccccCcccccccc
Q 015023           15 RRDPYEVLCVSRDSSDQEIKTAYRKLALKYHPDKNVSNPEAAELFKEVAYSYSILSDPEKRRHYDNAGFEAID   87 (414)
Q Consensus        15 ~~d~Y~iLgv~~~as~~eIk~ayr~la~~~HPDk~~~~~~a~~~f~~i~~AyevLsdp~kR~~YD~~G~~~~~   87 (414)
                      .+|||+||||+++||.++||+|||+|++++|||++++++.+.+.|..|++||+||+||.+|+.||++|..+++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            4699999999999999999999999999999999998888999999999999999999999999999987653
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure