Citrus Sinensis ID: 015029


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKEFVGLLMQNAVYLCWNYELLRRVGNKNICLNIRSLDIFSEGFCLFISEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSVSGSPRPTYPSSKPTRVDWDKLEAQVKKEEKEEKLDGDAALNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMKKWEY
cHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHccccHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccccccEEEEEEcEEEEEEEcccccCEEEccccccccccccccEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccc
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKEFVGLLMQNAVYLCWNYELLRRV************DIFSEGFCLFISEETGELQKQPL*******V*TNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWS*L*******************************************************ALNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMKKWE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKEFVGLLMQNAVYLCWNYELLRRVGNKNICLNIRSLDIFSEGFCLFISEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSVSGSPRPTYPSSKPTRVDWDKLEAQVKKEEKEEKLDGDAALNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMKKWEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SGT1 homolog Involved in basal disease resistance to bacterial blight (X.oryzae). May act as positive regulator of basal defense. Probably required for SCF-mediated ubiquitination, by coupling HSP90 to SCF complex for ubiquitination of HSP90 client proteins.probableQ0JL44
Protein SGT1 homolog A Functions in R gene-mediated resistance, but participates in a lower extent than SGT1B to RPP5-mediated resistance. Not required for RPM1, RPS2, RPS4 and RPS5-mediated resistance. Probably required for SCF-mediated ubiquitination, by coupling HSP90 to SCF complex for ubiquitination of HSP90 client proteins.probableQ9SUR9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 5-124
View the alignment between query and template
View the model in PyMOL
Template: 2KMW, chain A
Confidence level:very confident
Coverage over the Query: 214-304,320-341
View the alignment between query and template
View the model in PyMOL
Template: 2O30, chain A
Confidence level:confident
Coverage over the Query: 214-301
View the alignment between query and template
View the model in PyMOL