Citrus Sinensis ID: 015037

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
cccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccccEEEEEEEEEEccccccccEEEEEcccccHHHHHHHHHHHccEEEEEccccccccEEEEccccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccccEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHccccccccccccEEccEEEEEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHccHEcccccccccccEEEEEEEEEEcccccEEEEEEEEcccccHHHccEEEEEcccccEccHHHHHcccccEEEEEEccccccccEEEccccHHHccEEEEEcccccccccEEccHHHHcccHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEEEEcccccccccccccEcEEHcHHHEcHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHccHHHHHHHccccccccccEEccccccccccHHcHHHHHHHHHHcccEEEEEEcccccEEccHHHHHHHHHcccccccccccEEEcccEEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHccccc
MDKLCFPLLLLLLLVQLCMQLAASYStvkflpgfqgplpfeletgyvgvgesgdAQLFYYFVKseknpredplllwltggpgcsafsglayeigpinfnvveyngslptlhlnpyswtkeasilfvdspvgtgysyaktplasqagdfkQVQQVDQFLRKWLldhpellsnpvyiggdsysgLVVPALVQQISNeneedikplinlqgyilgnaateptveenskipfahgmglisNELYESLkmgcggeyvnvdpknevCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRlgskgewqrcnfglpyarEIHSSFSYHVSLSTKGYrsliysgdhdmmvpflGTEAWIKSLNYsivddwrpwilhsqvagytrtysnrmtyatvkggghtapeyrpaECYAMFQRWINHDPL
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
MDKlcfplllllllvqlcmqlAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
***LCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWIN****
**KLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
*DKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINH***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q9C7D6437 Serine carboxypeptidase-l yes no 0.997 0.945 0.552 1e-141
Q9CAU3441 Serine carboxypeptidase-l no no 0.951 0.893 0.574 1e-140
Q9SQX6437 Serine carboxypeptidase-l no no 0.951 0.901 0.571 1e-140
Q8VZU3465 Serine carboxypeptidase-l no no 0.992 0.883 0.529 1e-140
Q9CAU1441 Serine carboxypeptidase-l no no 0.980 0.920 0.553 1e-139
Q8RWJ6441 Serine carboxypeptidase-l no no 0.951 0.893 0.576 1e-139
Q9CAU2438 Serine carboxypeptidase-l no no 0.946 0.894 0.566 1e-138
Q9CAU4441 Serine carboxypeptidase-l no no 0.951 0.893 0.569 1e-138
Q9CAU0452 Serine carboxypeptidase-l no no 0.942 0.862 0.574 1e-138
Q9C7Z9464 Serine carboxypeptidase-l no no 0.942 0.840 0.541 1e-136
>sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 Back     alignment and function desciption
 Score =  502 bits (1293), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 315/438 (71%), Gaps = 25/438 (5%)

Query: 1   MDKLCFPL--LLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLF 58
           M K C+ L  +L   L+ + +QL  S ST++FLPGFQGPLPFELETGY+GVGE+   Q+F
Sbjct: 1   MGKECYYLSWILKFHLLLVLIQLVDSGSTIRFLPGFQGPLPFELETGYIGVGEAEKDQMF 60

Query: 59  YYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWT 118
           YYF+KSE NP +DPLLLWL+GGP CS+F+ L YE GPI F   EYNGS+P+L    Y+WT
Sbjct: 61  YYFIKSESNPEKDPLLLWLSGGPFCSSFTALIYENGPIAFKAEEYNGSIPSLVSTTYAWT 120

Query: 119 KEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGD 178
           K ASIL++D PVGTG+SY++ PLA    D    + V++FL KWL  HPE LSNP+Y+ G+
Sbjct: 121 KVASILYLDQPVGTGFSYSRNPLADIPSDTGVAKPVNEFLHKWLDKHPEFLSNPLYVAGN 180

Query: 179 SYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNE 238
           SYSG+V+P +VQ+ISN N  D KP INLQG++LGN AT+  ++ NS+IPFAHG  LIS+E
Sbjct: 181 SYSGIVIPTIVQEISNGNHLDSKPQINLQGFVLGNPATDTDIDLNSRIPFAHGKALISDE 240

Query: 239 LYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKTYG----------------------YLL 276
            YESLK  C G Y++V+P+N  CL  ++ F K                         + L
Sbjct: 241 HYESLKRSCQGNYISVNPRNTKCLKLLEDFKKCVSGISEEYILKPDCMWLYSCMANLHSL 300

Query: 277 SYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGD 336
           S YW N+ +VRKAL +  G+  +W RCN  + Y ++I SS  YH  +S +GYRSL++SGD
Sbjct: 301 SEYWANEKSVRKALLVNEGTVRKWIRCNTEIAYNKDIRSSVPYHKYISIEGYRSLVFSGD 360

Query: 337 HDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEY 396
           HDM+VPFLGT+AWI+SLNYSIVDDWRPW++ +QVAGYTRTY+N+MT+ATVKGGGHT+ EY
Sbjct: 361 HDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRTYANKMTFATVKGGGHTS-EY 419

Query: 397 RPAECYAMFQRWINHDPL 414
           +P E Y M +RW++  PL
Sbjct: 420 KPVETYIMIKRWLSGQPL 437
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU2|SCP5_ARATH Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAU4|SCP4_ARATH Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
224121832428 predicted protein [Populus trichocarpa] 0.992 0.960 0.656 1e-160
255538024468 serine carboxypeptidase, putative [Ricin 0.983 0.869 0.601 1e-160
224121828433 predicted protein [Populus trichocarpa] 0.944 0.903 0.647 1e-159
302142177503 unnamed protein product [Vitis vinifera] 0.983 0.809 0.586 1e-154
225458878469 PREDICTED: serine carboxypeptidase-like 0.983 0.867 0.586 1e-154
255538022453 serine carboxypeptidase, putative [Ricin 0.903 0.825 0.612 1e-150
356546524 546 PREDICTED: serine carboxypeptidase-like 0.973 0.738 0.583 1e-150
165994488487 1-O-acylglucose:anthocyanin-O-acyltransf 0.958 0.815 0.587 1e-148
356514501418 PREDICTED: serine carboxypeptidase-like 0.980 0.971 0.623 1e-148
165994490469 1-O-acylglucose:anthocyanin-O-acyltransf 0.954 0.842 0.591 1e-148
>gi|224121832|ref|XP_002330664.1| predicted protein [Populus trichocarpa] gi|222872268|gb|EEF09399.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  572 bits (1474), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 283/431 (65%), Positives = 335/431 (77%), Gaps = 20/431 (4%)

Query: 1   MDKLCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYY 60
           M K C P LLLL +    +QLAA++STVK+LPGF+GPLPF LETGYVGV E+ D QLFYY
Sbjct: 1   MAKQCLPFLLLLQVW---LQLAAAHSTVKYLPGFKGPLPFHLETGYVGVDEAEDVQLFYY 57

Query: 61  FVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKE 120
           F+KS++N ++DPLLLWLTGGPGCSAFSGLA+EIGPINF   EYNGSLPTL        + 
Sbjct: 58  FIKSQRNSKDDPLLLWLTGGPGCSAFSGLAFEIGPINFEEKEYNGSLPTLMAALLINFQV 117

Query: 121 ASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSY 180
           +SI+F+D PV TG+SYA+TPLA Q  DFKQV Q +QFLRKWL+DH ELLSNPVYI GDSY
Sbjct: 118 SSIIFLDLPVSTGFSYARTPLALQRSDFKQVSQAEQFLRKWLMDHQELLSNPVYISGDSY 177

Query: 181 SGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELY 240
           SG++VPA+VQ+ISN N +  KPLINL+GY LGN  T+PT + NS+IPF+HGMGLIS+ELY
Sbjct: 178 SGIIVPAVVQKISNGNNDGTKPLINLKGYTLGNPFTDPTFDLNSRIPFSHGMGLISDELY 237

Query: 241 ESLKMGCGGEYVNVDPKNEVCLNDIQAFSK-----------------TYGYLLSYYWNND 283
           ESLK  CGGEY ++DPKN  CL +++A  K                 TYG+LL+ YW ND
Sbjct: 238 ESLKKSCGGEYQSIDPKNSECLENLEARDKCISEIEESHILERKCPSTYGHLLATYWAND 297

Query: 284 YNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPF 343
            NVRKAL +R GS GEWQRCN+  PY  EI SS   H+ L  +GYR LIYSGDHDM VPF
Sbjct: 298 DNVRKALHVREGSIGEWQRCNYKSPYTHEIKSSVKNHIDLGIEGYRRLIYSGDHDMEVPF 357

Query: 344 LGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYA 403
           LGT+AWI+SLNYSIVDDW PW    QVAGYTRTYS+++T+ATVKGGGHTAP YRPAEC+A
Sbjct: 358 LGTQAWIRSLNYSIVDDWHPWHFQGQVAGYTRTYSSQLTFATVKGGGHTAPGYRPAECFA 417

Query: 404 MFQRWINHDPL 414
           MF+RWI  +PL
Sbjct: 418 MFKRWIVQEPL 428

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538024|ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550778|gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224121828|ref|XP_002330663.1| predicted protein [Populus trichocarpa] gi|222872267|gb|EEF09398.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302142177|emb|CBI19380.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458878|ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255538022|ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550777|gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356546524|ref|XP_003541676.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max] Back     alignment and taxonomy information
>gi|165994488|dbj|BAF99694.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea] Back     alignment and taxonomy information
>gi|356514501|ref|XP_003525944.1| PREDICTED: serine carboxypeptidase-like 7-like [Glycine max] Back     alignment and taxonomy information
>gi|165994490|dbj|BAF99695.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2144751465 SCPL19 "serine carboxypeptidas 0.582 0.518 0.614 5.2e-136
TAIR|locus:2075755437 SCPL7 "serine carboxypeptidase 0.596 0.565 0.599 1.6e-134
TAIR|locus:2197294441 scpl2 "serine carboxypeptidase 0.611 0.573 0.588 2e-134
TAIR|locus:2158946441 scpl1 "serine carboxypeptidase 0.596 0.560 0.599 7.6e-133
TAIR|locus:2082249437 scpl17 "serine carboxypeptidas 0.596 0.565 0.599 1.6e-132
TAIR|locus:2197299438 scpl5 "serine carboxypeptidase 0.591 0.559 0.582 2e-132
TAIR|locus:2197309452 scpl6 "serine carboxypeptidase 0.596 0.546 0.599 2.6e-132
TAIR|locus:2197304441 scpl3 "serine carboxypeptidase 0.599 0.562 0.580 8.7e-132
TAIR|locus:2197259441 scpl4 "serine carboxypeptidase 0.596 0.560 0.595 4.8e-131
TAIR|locus:2059175435 SCPL12 "serine carboxypeptidas 0.596 0.567 0.582 8.8e-130
TAIR|locus:2144751 SCPL19 "serine carboxypeptidase-like 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 856 (306.4 bits), Expect = 5.2e-136, Sum P(2) = 5.2e-136
 Identities = 148/241 (61%), Positives = 190/241 (78%)

Query:    28 VKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFS 87
             VK LPGF+GPLPFELETGYV +GESGD +LFYYFVKSE+NP  DPL++WLTGGPGCS+  
Sbjct:    27 VKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSIC 86

Query:    88 GLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGD 147
             GL +  GP+ F   EYNG++P L L  +SWTK A+IL++++P G+GYSYAKT  A ++ D
Sbjct:    87 GLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSD 146

Query:   148 FKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQ 207
              KQ+ Q+DQFLR W + HPE +SNP Y+GGDSYSG +VP  VQQIS  NE+ + PLIN+Q
Sbjct:   147 TKQMHQIDQFLRSWFVKHPEFISNPFYVGGDSYSGKIVPGAVQQISLGNEKGLTPLINIQ 206

Query:   208 GYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQA 267
             GY+LGN  T+  +E N ++PFAHGMGLIS+EL+ESL+  CGG++ NVDP N  C N++QA
Sbjct:   207 GYVLGNPVTDKNIETNYRVPFAHGMGLISDELFESLERSCGGKFFNVDPSNARCSNNLQA 266

Query:   268 F 268
             +
Sbjct:   267 Y 267
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0016752 "sinapoyltransferase activity" evidence=IMP
GO:0019748 "secondary metabolic process" evidence=IMP
TAIR|locus:2075755 SCPL7 "serine carboxypeptidase-like 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197294 scpl2 "serine carboxypeptidase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158946 scpl1 "serine carboxypeptidase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082249 scpl17 "serine carboxypeptidase-like 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197299 scpl5 "serine carboxypeptidase-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197309 scpl6 "serine carboxypeptidase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197304 scpl3 "serine carboxypeptidase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197259 scpl4 "serine carboxypeptidase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059175 SCPL12 "serine carboxypeptidase-like 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C7D6SCP17_ARATH3, ., 4, ., 1, 6, ., -0.55250.99750.9450yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.160.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 1e-171
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 1e-167
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-159
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 1e-115
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 8e-46
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 3e-33
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information 
 Score =  487 bits (1254), Expect = e-171
 Identities = 236/439 (53%), Positives = 301/439 (68%), Gaps = 32/439 (7%)

Query: 4   LCFPLLLLLLLVQLCMQLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVK 63
           L    +LL+LLV        S S VKFLPGF+GPLPFELETGY+G+GE  + Q FYYF+K
Sbjct: 3   LILKFMLLILLVS--SHHVRSGSIVKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIK 60

Query: 64  SEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASI 123
           S+KNP+EDPL++WL GGPGCS  SGL +E GP+      YNGS+P+L    YSWTK A+I
Sbjct: 61  SDKNPQEDPLIIWLNGGPGCSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANI 120

Query: 124 LFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGL 183
           +F+D PVG+G+SY+KTP+  +  D  +V+++ +FL+KWL+ HP+ LSNP Y+ GDSYSG+
Sbjct: 121 IFLDQPVGSGFSYSKTPI-ERTSDTSEVKKIHEFLQKWLIKHPQFLSNPFYVVGDSYSGM 179

Query: 184 VVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESL 243
           +VPALV +IS  N     P INLQGY+LGN  T    E+N +IP+AHGM LIS+ELYESL
Sbjct: 180 IVPALVHEISKGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESL 239

Query: 244 KMGCGGEYVNVDPKNEVCLNDIQAFSKT----------------------------YGYL 275
           K  C G Y +VDP N+ CL  ++ + K                             Y Y 
Sbjct: 240 KRICKGNYFSVDPSNKKCLKLVEEYHKCTDNINSHHTLIANCDDSNTQHISPDCYYYPYH 299

Query: 276 LSYYWNNDYNVRKALRIRLGSKGEWQRCNFGLPYAREIHSSFSYHVSLSTKGYRSLIYSG 335
           L   W N+ +VR+AL +  GS GEW R + G+PY  +I SS  YH++ S  GYRSLI+SG
Sbjct: 300 LVECWANNESVREALHVDKGSIGEWIRDHRGIPYKSDIRSSIPYHMNNSINGYRSLIFSG 359

Query: 336 DHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNRMTYATVKGGGHTAPE 395
           DHD+ +PF  T+AWIKSLNYSI+DDWRPW++  Q+AGYTRTYSN+MT+ATVKGGGHTA E
Sbjct: 360 DHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTRTYSNKMTFATVKGGGHTA-E 418

Query: 396 YRPAECYAMFQRWINHDPL 414
           Y P E   MFQRWI+  PL
Sbjct: 419 YLPEESSIMFQRWISGQPL 437

Length = 437
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02209437 serine carboxypeptidase 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 100.0
PLN02824294 hydrolase, alpha/beta fold family protein 99.6
PRK00870302 haloalkane dehalogenase; Provisional 99.6
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.58
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.58
PRK03204286 haloalkane dehalogenase; Provisional 99.55
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.54
PRK10673255 acyl-CoA esterase; Provisional 99.53
PHA02857276 monoglyceride lipase; Provisional 99.52
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.48
PLN02385349 hydrolase; alpha/beta fold family protein 99.48
PLN02298330 hydrolase, alpha/beta fold family protein 99.46
PRK03592295 haloalkane dehalogenase; Provisional 99.46
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.46
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.44
PLN02679360 hydrolase, alpha/beta fold family protein 99.43
PLN02578354 hydrolase 99.42
PRK10349256 carboxylesterase BioH; Provisional 99.42
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.4
PRK06489360 hypothetical protein; Provisional 99.39
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.38
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.38
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.36
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.34
PLN02894402 hydrolase, alpha/beta fold family protein 99.32
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.31
PLN02652395 hydrolase; alpha/beta fold family protein 99.31
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.3
PLN02965255 Probable pheophorbidase 99.29
PRK10749330 lysophospholipase L2; Provisional 99.29
PRK08775343 homoserine O-acetyltransferase; Provisional 99.27
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.27
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.25
PRK07581339 hypothetical protein; Validated 99.22
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.21
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.16
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.12
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.07
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.02
PLN02511388 hydrolase 98.98
COG2267298 PldB Lysophospholipase [Lipid metabolism] 98.97
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.94
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.91
PLN02211273 methyl indole-3-acetate methyltransferase 98.91
PRK05855 582 short chain dehydrogenase; Validated 98.83
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.81
PRK10985324 putative hydrolase; Provisional 98.81
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.8
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.79
PRK10566249 esterase; Provisional 98.72
KOG1455313 consensus Lysophospholipase [Lipid transport and m 98.7
PLN02872395 triacylglycerol lipase 98.65
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.63
PRK06765389 homoserine O-acetyltransferase; Provisional 98.62
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.57
PLN02442283 S-formylglutathione hydrolase 98.51
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.22
PRK13604307 luxD acyl transferase; Provisional 98.22
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.12
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.05
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.03
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.02
PRK11071190 esterase YqiA; Provisional 98.0
PRK11460232 putative hydrolase; Provisional 98.0
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.9
PRK10115686 protease 2; Provisional 97.89
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.88
KOG2564343 consensus Predicted acetyltransferases and hydrola 97.81
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.74
COG3208244 GrsT Predicted thioesterase involved in non-riboso 97.72
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.72
KOG1552258 consensus Predicted alpha/beta hydrolase [General 97.52
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 97.44
COG0400207 Predicted esterase [General function prediction on 97.4
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 97.32
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 97.25
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.25
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.16
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.14
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.02
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 96.95
PLN00021313 chlorophyllase 96.93
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 96.81
COG1647243 Esterase/lipase [General function prediction only] 96.8
KOG1838409 consensus Alpha/beta hydrolase [General function p 96.68
PRK10162318 acetyl esterase; Provisional 96.47
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.4
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 96.34
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.33
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 96.23
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 96.14
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.1
KOG2931326 consensus Differentiation-related gene 1 protein ( 96.09
KOG2984277 consensus Predicted hydrolase [General function pr 95.89
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 95.87
PRK07868 994 acyl-CoA synthetase; Validated 95.8
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 95.73
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 95.54
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 95.34
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 95.25
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 95.17
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 94.89
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 94.72
KOG4667269 consensus Predicted esterase [Lipid transport and 94.48
cd00312493 Esterase_lipase Esterases and lipases (includes fu 94.12
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 93.5
PLN02454414 triacylglycerol lipase 93.5
COG4099387 Predicted peptidase [General function prediction o 93.46
PRK102521296 entF enterobactin synthase subunit F; Provisional 93.12
COG0657312 Aes Esterase/lipase [Lipid metabolism] 92.54
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 92.22
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 91.82
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 91.26
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 91.25
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 91.1
PLN02571413 triacylglycerol lipase 90.72
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 90.38
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 90.31
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 90.27
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 90.14
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 89.97
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 89.96
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 89.35
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 88.38
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 87.57
PLN02753531 triacylglycerol lipase 87.0
KOG3975301 consensus Uncharacterized conserved protein [Funct 86.91
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 86.88
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 86.63
PLN02719518 triacylglycerol lipase 86.49
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 86.31
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 86.17
COG3319257 Thioesterase domains of type I polyketide synthase 86.05
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 85.67
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 85.53
PRK04940180 hypothetical protein; Provisional 85.0
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 84.46
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 84.35
COG4757281 Predicted alpha/beta hydrolase [General function p 84.13
KOG2183492 consensus Prolylcarboxypeptidase (angiotensinase C 83.72
COG2945210 Predicted hydrolase of the alpha/beta superfamily 83.55
PLN02324415 triacylglycerol lipase 83.16
PLN02761527 lipase class 3 family protein 83.05
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 82.49
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 81.37
KOG3101283 consensus Esterase D [General function prediction 80.8
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-111  Score=832.27  Aligned_cols=389  Identities=51%  Similarity=0.902  Sum_probs=354.8

Q ss_pred             hhhcCCCccccCCCCCCCCCceeEEEEEEecCCCCeeEEEEEEecCCCCCCCCEEEEECCCCchHHHHHHhHhcCCeEEe
Q 015037           20 QLAASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFN   99 (414)
Q Consensus        20 ~~~~~~~~v~~lpg~~~~~~~~~~sGy~~v~~~~~~~lfy~~~~s~~~~~~~PlilWlnGGPG~SS~~g~f~e~GP~~~~   99 (414)
                      ..+.++++|+.|||++.++++++|||||+|++..+++|||||+||+++|+++||||||||||||||+.|+|.|+|||+++
T Consensus        22 ~~~~~~~~I~~LPG~~~~~~f~~ysGYv~v~~~~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl~G~~~E~GPf~v~  101 (454)
T KOG1282|consen   22 HHVDEADLIKSLPGQPGPLPFKQYSGYVTVNESEGRQLFYWFFESENNPETDPLVLWLNGGPGCSSLGGLFEENGPFRVK  101 (454)
T ss_pred             cccchhhhhhcCCCCCCCCCcccccceEECCCCCCceEEEEEEEccCCCCCCCEEEEeCCCCCccchhhhhhhcCCeEEc
Confidence            36678899999999988899999999999998788999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCeeccCCccccCCCceEEEeCCCcccccCccCCCCcccChhHHHHHHHHHHHHHHHhCCCCCCCCEEEEccc
Q 015037          100 VVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDS  179 (414)
Q Consensus       100 ~~~~~~~~~~~~~n~~sW~~~anllyiDqPvG~GfS~~~~~~~~~~~~~~~a~~~~~fL~~f~~~fp~~~~~~~~i~GES  179 (414)
                      .++.     +|..||||||+.||||||||||||||||+++..++.++|+.+|+|++.||++||++||||++|||||+|||
T Consensus       102 ~~G~-----tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GES  176 (454)
T KOG1282|consen  102 YNGK-----TLYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYKTGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGES  176 (454)
T ss_pred             CCCC-----cceeCCccccccccEEEEecCCcCCccccCCCCcCcCCcHHHHHHHHHHHHHHHHhChhhcCCCeEEeccc
Confidence            5432     59999999999999999999999999999988888789999999999999999999999999999999999


Q ss_pred             ccccchHHHHHHHHhccccCCCcccccceeEEecccCCcccccCcchhhhhccCccCHHHHHHHHhhhcC---cccccCC
Q 015037          180 YSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGG---EYVNVDP  256 (414)
Q Consensus       180 YgG~yvp~la~~i~~~~~~~~~~~inl~Gi~igng~~dp~~~~~~~~~~~~~~gli~~~~~~~~~~~c~~---~~~~~~~  256 (414)
                      |||||||+||.+|++.|+....+.|||||++||||++|+..|..++.+|++.||+|++++++.+.+.|..   ++..+.+
T Consensus       177 YAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~  256 (454)
T KOG1282|consen  177 YAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDP  256 (454)
T ss_pred             ccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCC
Confidence            9999999999999999976556789999999999999999999999999999999999999999999987   4555566


Q ss_pred             CChhHHHHHHHHHh---------------hcC-----------c-------hhhhhccCCHHHHHHhCCCCCCcCCcccc
Q 015037          257 KNEVCLNDIQAFSK---------------TYG-----------Y-------LLSYYWNNDYNVRKALRIRLGSKGEWQRC  303 (414)
Q Consensus       257 ~~~~C~~~~~~~~~---------------~~~-----------~-------~~~~~ylN~~~V~~aL~v~~~~~~~w~~c  303 (414)
                      .+..|.++++.+..               |..           .       +..+.|||+++||+||||+......|..|
T Consensus       257 ~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~~~W~~C  336 (454)
T KOG1282|consen  257 SNTKCNKAVEEFDSKTTGDIDNYYILTPDCYPTSYELKKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSIGKWERC  336 (454)
T ss_pred             chhHHHHHHHHHHHHHhccCchhhhcchhhccccccccccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCCCccccc
Confidence            67889998876552               221           0       11245999999999999987643389999


Q ss_pred             cCCc--ccCccccchHHHHHHhhhcC-ceEEEEecCCccccCchhHHHHHHhcCCCcCcCcceEEeC-CeEeEEEEEecc
Q 015037          304 NFGL--PYAREIHSSFSYHVSLSTKG-YRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILH-SQVAGYTRTYSN  379 (414)
Q Consensus       304 ~~~~--~~~~d~~~~~~~~~~Ll~~~-irVLiy~Gd~D~i~~~~g~~~~~~~L~w~~~~~~~~w~~~-~~~~G~~k~~~~  379 (414)
                      |..+  .|.++..++++.+..++.++ +|||||+||.|++||+.|+++|+++|+++..++||||+.+ +|++||+++|+ 
T Consensus       337 n~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~L~~~~~~~~~pW~~~~~qvaG~~~~Y~-  415 (454)
T KOG1282|consen  337 NDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKSLNLSITDEWRPWYHKGGQVAGYTKTYG-  415 (454)
T ss_pred             ChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHhccCccccCccCCccCCCceeeeEEEec-
Confidence            9987  46788889999999988865 9999999999999999999999999999999999999995 89999999997 


Q ss_pred             ceEEEEEcCcccccCCCCcHHHHHHHHHHHcCCCC
Q 015037          380 RMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  414 (414)
Q Consensus       380 ~Ltf~~V~~AGHmvP~dqP~~a~~~i~~fl~~~~~  414 (414)
                      +|+|++|+|||||||.|||+++++||++||.|+++
T Consensus       416 ~ltf~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l  450 (454)
T KOG1282|consen  416 GLTFATVRGAGHMVPYDKPESALIMFQRFLNGQPL  450 (454)
T ss_pred             CEEEEEEeCCcccCCCCCcHHHHHHHHHHHcCCCC
Confidence            59999999999999999999999999999999875

>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 4e-32
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 2e-18
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 9e-32
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 4e-30
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 4e-29
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 3e-28
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 3e-28
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 3e-28
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 6e-28
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 9e-22
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 2e-18
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 4e-18
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 7e-11
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 3e-09
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 3e-09
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-09
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-09
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 136/254 (53%), Gaps = 16/254 (6%)
Query: 22  AASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGP 81
           A     ++ LPG      F   +GY+    SG   L Y+FV+S+K+P   P++LWL GGP
Sbjct: 1   APDQDEIQRLPGLAKQPSFRQYSGYLK--SSGSKHLHYWFVESQKDPENSPVVLWLNGGP 58
Query: 82  GCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPL 141
           GCS+  GL  E GP    +V+ +G   TL  NPYSW   A++L+++SP G G+SY+    
Sbjct: 59  GCSSLDGLLTEHGPF---LVQPDGV--TLEYNPYSWNLIANVLYLESPAGVGFSYSDDKF 113
Query: 142 ASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEEDIK 201
            +   D +  Q   + L+ +    PE  +N +++ G+SY+G+ +P L   +  +      
Sbjct: 114 YA-TNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQD------ 166
Query: 202 PLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGE-YVNV-DPKNE 259
           P +NLQG  +GN  +     +NS + FA+  GL+ N L+ SL+  C  +   N  D K+ 
Sbjct: 167 PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDL 226
Query: 260 VCLNDIQAFSKTYG 273
            C+ ++Q  ++  G
Sbjct: 227 ECVTNLQEVARIVG 240
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-113
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-104
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-101
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-101
1ivy_A452 Human protective protein; carboxypeptidase, serine 3e-96
1ivy_A452 Human protective protein; carboxypeptidase, serine 2e-47
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-57
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 2e-54
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
 Score =  337 bits (867), Expect = e-113
 Identities = 104/438 (23%), Positives = 169/438 (38%), Gaps = 81/438 (18%)

Query: 32  PGFQGPLP-FELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLA 90
           P   G  P     TGY+ V +      F++  +S  +P +DP++LWL GGPGCS+ +GL 
Sbjct: 5   PKILGIDPNVTQYTGYLDVEDEDKH-FFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLF 63

Query: 91  YEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQ 150
           + +GP +               NPYSW   A+++F+D PV  G+SY+ +   S       
Sbjct: 64  FALGPSSIG------PDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVS--NTVAA 115

Query: 151 VQQVDQFLRKWLLDHPELL--SNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQG 208
            + V  FL  +    PE +      +I G SY+G  +P    +I +          NL  
Sbjct: 116 GKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHK----DRNFNLTS 171

Query: 209 YILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAF 268
            ++GN  T+P  + N   P A G G   + L          E   ++   E CL  I++ 
Sbjct: 172 VLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSE-------ECSAMEDSLERCLGLIESC 224

Query: 269 SKTYGY-------------LLSYYWNNDYN-----------------------------V 286
             +                 L+ Y     N                             V
Sbjct: 225 YDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYV 284

Query: 287 RKALRIRLGSKGEWQRCNFGLPYARE-----IHSSFSYHVSLSTKGYRSLIYSGDHDMMV 341
           ++A+   +     ++ CNF +          +    +    L  +    L+Y+GD D + 
Sbjct: 285 KEAVGAEVD---HYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFIC 341

Query: 342 PFLGTEAWIKSLNYSIVDDW-----RPWILHS--QVAGYTRTYSNRMTYATVKGGGHTAP 394
            +LG +AW   L +   +++     R W      +VAG  ++Y +  TY  V  GGH  P
Sbjct: 342 NWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKH-FTYLRVFNGGHMVP 400

Query: 395 EYRPAECYAMFQRWINHD 412
              P    +M   WI+  
Sbjct: 401 FDVPENALSMVNEWIHGG 418
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.64
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.63
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.61
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.6
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.6
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.59
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.59
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.59
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.58
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.58
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.58
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.57
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.57
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.57
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.57
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.56
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.56
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.55
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.55
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.55
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.55
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.54
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.54
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.54
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.53
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.53
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.53
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.53
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.52
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.52
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.52
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.52
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.52
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.52
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.51
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.51
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.51
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.51
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.51
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.51
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.5
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.5
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.5
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.5
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.5
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.49
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.49
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.49
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.49
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.48
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.48
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.48
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.47
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.47
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.47
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.46
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.46
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.45
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.45
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.45
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.44
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.44
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.43
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.43
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.41
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.41
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.4
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.39
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.39
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.38
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.38
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.36
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.35
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.34
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.34
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.33
3h04_A275 Uncharacterized protein; protein with unknown func 99.33
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.32
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.32
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.32
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.99
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.31
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.31
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.31
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.31
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.31
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.29
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.28
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.28
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.27
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.26
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.25
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.25
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.25
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.25
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.24
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.23
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.2
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.2
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.19
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.18
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.15
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.14
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.13
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.12
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.11
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.11
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.11
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.1
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.1
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.09
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.07
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.07
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.06
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.06
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.05
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.05
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.05
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.04
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.03
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.03
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.03
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.03
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.01
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.0
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.99
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.96
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.96
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.95
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.95
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.92
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.92
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.91
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.91
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.9
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.89
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.89
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.89
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.88
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.86
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.86
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.86
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.86
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.85
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.83
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.82
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.8
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.79
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.75
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.74
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.74
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.74
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.74
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.74
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.72
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.72
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.71
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.69
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.66
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.65
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.64
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.63
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.59
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.57
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.57
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.57
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.55
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.54
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.53
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.52
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.49
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.49
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.42
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.4
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.39
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.39
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.38
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.38
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.37
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.36
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.35
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.3
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.29
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.28
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.24
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.08
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.06
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.02
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.02
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.0
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 97.98
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.97
3lp5_A250 Putative cell surface hydrolase; structural genom 97.94
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.84
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 97.8
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.72
3d59_A383 Platelet-activating factor acetylhydrolase; secret 97.67
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 97.58
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 97.5
3nuz_A398 Putative acetyl xylan esterase; structural genomic 97.46
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.46
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 97.44
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.41
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 97.27
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.19
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 97.17
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.16
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.15
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.1
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 97.05
4f21_A246 Carboxylesterase/phospholipase family protein; str 96.93
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 96.88
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 96.86
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 96.78
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.68
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 96.46
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 96.45
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 96.38
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 96.37
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 96.18
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 96.11
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 95.81
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 95.54
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 95.45
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 95.2
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 95.12
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 95.07
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 94.96
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 94.94
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 94.76
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 94.76
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 94.17
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 94.06
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 93.84
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 93.33
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 93.23
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 93.01
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 92.94
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 92.78
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 90.99
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 90.69
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 90.62
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 90.18
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 89.93
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 89.7
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 89.45
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 89.31
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 89.25
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 88.94
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 88.52
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 88.48
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 87.75
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 87.63
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 85.04
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=8e-98  Score=749.46  Aligned_cols=375  Identities=33%  Similarity=0.647  Sum_probs=333.0

Q ss_pred             cCCCccccCCCCCCCCCceeEEEEEEecCCCCeeEEEEEEecCCCCCCCCEEEEECCCCchHHHHHHhHhcCCeEEeccC
Q 015037           23 ASYSTVKFLPGFQGPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVE  102 (414)
Q Consensus        23 ~~~~~v~~lpg~~~~~~~~~~sGy~~v~~~~~~~lfy~~~~s~~~~~~~PlilWlnGGPG~SS~~g~f~e~GP~~~~~~~  102 (414)
                      ++.++|+.|||++.++++++|||||+|++  +++||||||||+++|+++||+|||||||||||+.|+|+|+|||+++.++
T Consensus         2 ~~~d~V~~LPg~~~~~~~~~~sGyv~v~~--~~~lfy~f~~s~~~~~~~Pl~lwlnGGPG~Ss~~g~~~e~GP~~~~~~~   79 (452)
T 1ivy_A            2 PDQDEIQRLPGLAKQPSFRQYSGYLKSSG--SKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDG   79 (452)
T ss_dssp             CTTTBCSSCTTCSSCCSSCEEEEEEECST--TEEEEEEEECCSSCGGGSCEEEEECCTTTBCTHHHHHTTTSSEEECTTS
T ss_pred             CccCccccCCCCCCCCCceeeEEEEeeCC--CCeEEEEEEEcCCCCCCCCEEEEECCCCcHHHHHHHHHhcCCcEEeCCC
Confidence            46899999999987889999999999975  6899999999999999999999999999999999999999999998643


Q ss_pred             CCCCCCeeccCCccccCCCceEEEeCCCcccccCccCCCCcccChhHHHHHHHHHHHHHHHhCCCCCCCCEEEEcccccc
Q 015037          103 YNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSG  182 (414)
Q Consensus       103 ~~~~~~~~~~n~~sW~~~anllyiDqPvG~GfS~~~~~~~~~~~~~~~a~~~~~fL~~f~~~fp~~~~~~~~i~GESYgG  182 (414)
                           .+++.||+||++.+||||||||+||||||... ..+.++++++|+|+++||++|+++||++++++|||+||||||
T Consensus        80 -----~~l~~n~~sw~~~~~~lfiDqP~GtGfS~~~~-~~~~~~~~~~a~~~~~~l~~f~~~~p~~~~~~~~i~GeSYgG  153 (452)
T 1ivy_A           80 -----VTLEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAG  153 (452)
T ss_dssp             -----SCEEECTTCGGGSSEEEEECCSTTSTTCEESS-CCCCCBHHHHHHHHHHHHHHHHHHSGGGTTSCEEEEEETTHH
T ss_pred             -----ceeeeCCCcccccccEEEEecCCCCCcCCcCC-CCCcCCcHHHHHHHHHHHHHHHHhcHHhcCCCEEEEeeccce
Confidence                 25999999999999999999999999999654 356668889999999999999999999999999999999999


Q ss_pred             cchHHHHHHHHhccccCCCcccccceeEEecccCCcccccCcchhhhhccCccCHHHHHHHHhhhcCccccc---CCCCh
Q 015037          183 LVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNV---DPKNE  259 (414)
Q Consensus       183 ~yvp~la~~i~~~~~~~~~~~inl~Gi~igng~~dp~~~~~~~~~~~~~~gli~~~~~~~~~~~c~~~~~~~---~~~~~  259 (414)
                      +|+|.+|.+|++.      .++||+|++||||++||..|...+.+|++.+|+|+++.++.+.+.|.... .+   ...+.
T Consensus       154 ~y~p~la~~i~~~------~~~~l~g~~ign~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~-~~~~~~~~~~  226 (452)
T 1ivy_A          154 IYIPTLAVLVMQD------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQN-KCNFYDNKDL  226 (452)
T ss_dssp             HHHHHHHHHHTTC------TTSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETT-EECCSSCCCH
T ss_pred             eehHHHHHHHHhc------CccccceEEecCCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcc-cccccccchH
Confidence            9999999999864      26999999999999999999888999999999999999999999996421 11   23456


Q ss_pred             hHHHHHHHHHh---------------hc--------------------------------------------------Cc
Q 015037          260 VCLNDIQAFSK---------------TY--------------------------------------------------GY  274 (414)
Q Consensus       260 ~C~~~~~~~~~---------------~~--------------------------------------------------~~  274 (414)
                      .|..+++.+..               |.                                                  +.
T Consensus       227 ~C~~~~~~~~~~~~~~~in~Y~i~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pc~~~  306 (452)
T 1ivy_A          227 ECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNT  306 (452)
T ss_dssp             HHHHHHHHHHHHHHSSSCCTTCTTSCCTTCCSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEECCTTCCC
T ss_pred             HHHHHHHHHHHHHhcCCCcccccccccccccccccchhcccccccccchhhhhhhhccccccccccccccccCCCCccch
Confidence            78877654422               10                                                  11


Q ss_pred             hhhhhccCCHHHHHHhCCCCCCcCCcccccCCc--ccCccccchHHHHHHhhhc-CceEEEEecCCccccCchhHHHHHH
Q 015037          275 LLSYYWNNDYNVRKALRIRLGSKGEWQRCNFGL--PYAREIHSSFSYHVSLSTK-GYRSLIYSGDHDMMVPFLGTEAWIK  351 (414)
Q Consensus       275 ~~~~~ylN~~~V~~aL~v~~~~~~~w~~c~~~~--~~~~d~~~~~~~~~~Ll~~-~irVLiy~Gd~D~i~~~~g~~~~~~  351 (414)
                      .....|||+++||+||||+.. ...|..|+..+  .+.+...++.+.++.||++ |+|||||+||.|++||+.|+++|++
T Consensus       307 ~~~~~ylN~~~Vq~ALhv~~~-~~~W~~Cs~~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~Gt~~wi~  385 (452)
T 1ivy_A          307 TAASTYLNNPYVRKALNIPEQ-LPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVD  385 (452)
T ss_dssp             HHHHHHHTSHHHHHHTTCCTT-SCCCCSBCHHHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHHHHHHHH
T ss_pred             HHHHHHhCcHHHHHHcCCCCC-CCccccCcHHHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHHHHHHHH
Confidence            234679999999999999854 35799999877  3556667889999999998 9999999999999999999999999


Q ss_pred             hcCCCcCcCcceEEeC-C----eEeEEEEEeccceEEEEEcCcccccCCCCcHHHHHHHHHHHcCCCC
Q 015037          352 SLNYSIVDDWRPWILH-S----QVAGYTRTYSNRMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL  414 (414)
Q Consensus       352 ~L~w~~~~~~~~w~~~-~----~~~G~~k~~~~~Ltf~~V~~AGHmvP~dqP~~a~~~i~~fl~~~~~  414 (414)
                      +|+|++.++|+||+++ +    +++||+|+|+ ||||++|++||||||+|||++|++||++||.|++|
T Consensus       386 ~L~~~~~~~~~pw~~~~~~~~~~vaG~~~~y~-nLtf~tV~gAGHmVP~dqP~~al~m~~~fl~g~~l  452 (452)
T 1ivy_A          386 SLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFS-HIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY  452 (452)
T ss_dssp             HTCCCEEEEEEEEEEECTTSCEEEEEEEEEES-SEEEEEETTCCSSHHHHCHHHHHHHHHHHHTTCCC
T ss_pred             hcCCcccccceeeeeccCCCCcccceEEEEEc-ceEEEEECCCcccCcccChHHHHHHHHHHhcCCCC
Confidence            9999999999999976 5    9999999996 79999999999999999999999999999999986
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 414
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 1e-109
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 1e-101
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 2e-95
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 5e-92
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 6e-76
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.76
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.69
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.68
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.65
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.65
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.64
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.63
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.61
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.61
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.6
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.6
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.59
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.54
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.53
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.52
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.5
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.49
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.48
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.45
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.44
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.42
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.42
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.37
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.34
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.3
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.26
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.25
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.22
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.09
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.01
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.98
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.84
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.83
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.79
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.74
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.73
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.72
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.69
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.66
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.6
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.56
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.47
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.42
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.32
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.29
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.23
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.22
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.14
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.13
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.85
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.73
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.67
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.66
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.62
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.6
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 97.48
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 97.41
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.22
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.15
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.09
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 97.03
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 96.69
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 96.65
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 96.28
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 96.24
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 96.19
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 96.03
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 95.76
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 95.61
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 95.6
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 95.41
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 95.1
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 94.92
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 94.89
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 94.25
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 94.17
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 94.02
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 94.0
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 91.36
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 89.45
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 89.26
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 89.18
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 88.36
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 88.06
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 87.76
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 86.84
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 86.61
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure