Citrus Sinensis ID: 015038

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MHLPNGDVSGSLKSKFDDKVEPSSAKMYFHYYGQLLHQQNMLQDYVRTGTYYAAVIENRADFIGRVVVDVGAGSGILSLFAAQAGAKHVYAVEASEMAEYARKLIAGNPSLGERITVIKGKVEEVELPEKADILISEPMGTLLVNERMLETYVIARDRFLVPMGKMFPSVGRIHMAPFSDEYLFVEIANKALFWQQQNYYGVDLTPLYGSAFHGYFSQPVVDAFDPRLLVAPAVSHVIDFKKTKEENLYEIDIPLKFISSVGTRVHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQTSSCKLDLKEPYYRMSQPQPYVLTQDQQPHQLMHSQDIPIQADDLEEPELIQLQSQCSGAQLQ
ccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHcccccccEEEEEcCEEECcccccccEEEEcccccccccccHHHHHHHHHHHccccccEEcccccEEEEEEcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEccEEEEEEEEEEEEEcccccEEEEEccccccccccEEEEEEcccCEEEccccEEEEEEEEEEcccccEEEEEEEEEEECcccccccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*************************KMYFHYYGQLLHQQNMLQDYVRTGTYYAAVIENRADFIGRVVVDVGAGSGILSLFAAQAGAKHVYAVEASEMAEYARKLIAGNPSLGERITVIKGKVEEVELPEKADILISEPMGTLLVNERMLETYVIARDRFLVPMGKMFPSVGRIHMAPFSDEYLFVEIANKALFWQQQNYYGVDLTPLYGSAFHGYFSQPVVDAFDPRLLVAPAVSHVIDFKKTKEENLYEIDIPLKFISSVGTRVHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQTSSCKLDLKEPYYRMSQPQ********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLPNGDVSGSLKSKFDDKVEPSSAKMYFHYYGQLLHQQNMLQDYVRTGTYYAAVIENRADFIGRVVVDVGAGSGILSLFAAQAGAKHVYAVEASEMAEYARKLIAGNPSLGERITVIKGKVEEVELPEKADILISEPMGTLLVNERMLETYVIARDRFLVPMGKMFPSVGRIHMAPFSDEYLFVEIANKALFWQQQNYYGVDLTPLYGSAFHGYFSQPVVDAFDPRLLVAPAVSHVIDFKKTKEENLYEIDIPLKFISSVGTRVHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQTSSCKLDLKEPYYRMSQPQPYVLTQDQQPHQLMHSQDIPIQADDLEEPELIQLQSQCSGAQLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable histone-arginine methyltransferase CARM1 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability. Recruited to promoters upon gene activation, methylates histone H3 and activates transcription via chromatin remodeling.probableQ7XI75
Probable histone-arginine methyltransferase 1.4 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability. Recruited to promoters upon gene activation, methylates histone H3 and activates transcription via chromatin remodeling.probableA3KPF2
Probable histone-arginine methyltransferase CARMER Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in proteins. May methylate histone H3 at 'Arg-17' and activate transcription via chromatin remodeling. Coordinates ecdysone-mediated expression of cell death genes.probableQ9VH48

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.125Transferred entry: 2.1.1.124, 2.1.1.125 and 2.1.1.126.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y1W, chain A
Confidence level:very confident
Coverage over the Query: 16-368
View the alignment between query and template
View the model in PyMOL
Template: 1ORH, chain A
Confidence level:confident
Coverage over the Query: 29-366
View the alignment between query and template
View the model in PyMOL