Citrus Sinensis ID: 015059


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MENLNMALVSSTSPKLVLNYTNFKHPTRGITGPRRSSSLALPFKLSTSRISASVRAGPHQNGQVGAGGFASLTSSGGQQTSSVGVNPNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFGNAAFPQGSPFPFPNPPASGPTTPYPAASQPRFTMDIPATKVEAATATDVEGKKEVKGETEVKEEPKKYAFVDVSPEETLQKSSFDNFEDVKETSSSKDAQPPKDSQNGAAFNYNAGSPFGGQSAKKEGRFLTVDTLEKLMEDPQVQKMVYPSLPEEMRNPASFKLMLQNPEYRKQLQEMLDGMCESGEFDGRVLDSLKNFDLNSAEVKQQFEQIGLTPEEVITKMMANPEIALGFQSPRVQAAIMECSQNPMNIIKYQNDKEVFSDFV
cccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHcccccccccccHHccccccccccHHHHHHHHHHcccHHHHHHHHHccHHHHHHcccHHHHHHHHHHHccccHHHHccccHHHHcccc
***************L************************************************************************************PLFWVGVGVGLSALFSFVASRLKQYAMQ**********************************************************************************************************************************************************EKLMEDPQV**************************************C***EFDGRVLDSLKNFDLNSAEVKQQFEQIGLTPEEVITKMMANPEIALGFQSPRVQAAIMECSQNPMNIIKYQNDKEVFSDFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENLNMALVSSTSPKLVLNYTNFKHPTRGITGPRRSSSLALPFKLSTSRISASVRAGPHQNGQVGAGGFASLTSSGGQQTSSVGVNPNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFGNAAFPQGSPFPFPNPPASGPTTPYPAASQPRFTMDIPATKVEAATATDVEGKKEVKGETEVKEEPKKYAFVDVSPEETLQKSSFDNFEDVKETSSSKDAQPPKDSQNGAAFNYNAGSPFGGQSAKKEGRFLTVDTLEKLMEDPQVQKMVYPSLPEEMRNPASFKLMLQNPEYRKQLQEMLDGMCESGEFDGRVLDSLKNFDLNSAEVKQQFEQIGLTPEEVITKMMANPEIALGFQSPRVQAAIMECSQNPMNIIKYQNDKEVFSDFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TIC 40, chloroplastic Involved in protein precursor import into chloroplasts. Part of the motor complex consisting of a co-chaperone (TIC40) and a chaperone (HSP93) associated with the import channel (TIC110). Causes the release of bound transit peptides from TIC110 and stimulates ATP hydrolysis by HSP93. Involved in reinsertion of proteins from the chloroplast stroma into the inner membrane.probableQ9FMD5
Protein TIC 40, chloroplastic Involved in protein precursor import into chloroplasts. Part of the motor complex consisting of a co-chaperone (TIC40) and a chaperone (HSP93) associated with the import channel (TIC110). Causes the release of bound transit peptides from TIC110 and stimulates ATP hydrolysis by HSP93. Involved in reinsertion of proteins from the chloroplast stroma into the inner membrane.probableQ8GT66

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LLW, chain A
Confidence level:confident
Coverage over the Query: 361-413
View the alignment between query and template
View the model in PyMOL
Template: 2LNM, chain A
Confidence level:confident
Coverage over the Query: 280-332
View the alignment between query and template
View the model in PyMOL
Template: 1Q1F, chain A
Confidence level:probable
Coverage over the Query: 277-400
View the alignment between query and template
View the model in PyMOL