Citrus Sinensis ID: 015063

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccEEcccccccccccccccccccccccccccccccccHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccccccccccHHHHHHHHccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHcccccccccccccccccccccHHHHcccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEcccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccEcc
MANLKDIGVSAAINLLSAFAFLVVFAILRiqpvndrvyfpkwyrkgvrsspthsgtfankfVNLDLRTYLRFLNWmpdalkmpeselvdhagldSVAYLRIYLLGLKIFVPLAILAFVVLVPinwtgktlehatnvsfsdidklsisnipagskrLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLasqnrrpdqfTVLVrnippdpdesvseHVQHFfcvnhpdhyltHQVVYNANKLAQLVENKKSLRNWLTYYKNTyertskkpttktgfwglwgtrvdAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAqtqqsrnptiwltnwapeprdifwdnlsipyVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRkgvrsspthsgtfanKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLehatnvsfsdidklSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKntyertskkpttktgfwglwgtRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAqtqqsrnptiwltnWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
*****DIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNI*********EHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLT********KVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLI**
*ANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWY*********************DLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
**NLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGV**************VNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERTSKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q09809 793 Uncharacterized membrane yes no 0.804 0.419 0.235 4e-19
Q9P1W3 806 Transmembrane protein 63C yes no 0.657 0.337 0.266 1e-16
Q5T3F8 832 Transmembrane protein 63B no no 0.777 0.387 0.245 4e-16
Q91YT8 804 Transmembrane protein 63A yes no 0.840 0.432 0.238 5e-16
Q5R826 807 Transmembrane protein 63A no no 0.758 0.389 0.246 8e-16
Q3TWI9 832 Transmembrane protein 63B no no 0.777 0.387 0.245 2e-15
O94886 807 Transmembrane protein 63A no no 0.758 0.389 0.246 3e-15
O43022 865 Uncharacterized protein C no no 0.707 0.338 0.249 2e-14
Q09766 871 Uncharacterized membrane no no 0.756 0.359 0.238 9e-13
Q12252 991 Phosphate metabolism prot yes no 0.879 0.367 0.221 2e-12
>sp|Q09809|YAB9_SCHPO Uncharacterized membrane protein C2G11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 100/424 (23%), Positives = 184/424 (43%), Gaps = 91/424 (21%)

Query: 72  FLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPIN--WTGKT 129
           +  W+ D + +P+  + + AGLD   +L  + +G+K     ++L  ++++P+N  + G  
Sbjct: 68  YYKWLMDLVNIPDDVVQNCAGLDGYVFLLFFKMGIKFLSFASLLGVLIIMPVNKHFRGDA 127

Query: 130 LEHAT--------------------------------NVS------FSDIDKLS-ISNIP 150
             + T                                NV       F+ I  LS I  +P
Sbjct: 128 FGNITLSMPAKSEYFFSSPLVKKSIVQSPIIANGSELNVGVLGPSLFNPIGNLSDIPGLP 187

Query: 151 A-GSKRLYAHTIMSYVFTLWAFYVLRNEYKMIADMRLRFLASQNRRPDQFTVLVRNIPPD 209
             G   LY + + +Y  +++  YVL +  K IAD+R  +LA QNR  D+ TV +  +P +
Sbjct: 188 QPGDGFLYLYVLFTYFISIFLLYVLFSSTKSIADIRQSYLARQNRLTDR-TVFISGLPNE 246

Query: 210 PDESVSEHVQHFF-------------CVNHP--DHYLTHQVVYNANKLAQL----VENKK 250
                +E+++ +F             C N+   D  L+ +  Y   KL +     + N K
Sbjct: 247 --LCSTENLKAYFDKLDVGSIDSLSICRNYSYMDILLSKKSKY-VKKLEKYWSIYLSNCK 303

Query: 251 SL-------RNWLTYYKNTYERTSKK------------PTTKTGFWGLWGTRVDAIDYYT 291
            L        N+L+  +   E T ++            P  KT F+G++G ++DAID+Y+
Sbjct: 304 KLGISTLPPSNYLSPNRAELESTPEQLLEVPWQHHQCHPLIKTHFFGIFGQKIDAIDFYS 363

Query: 292 AEINKLTEE-ENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWL-TNWA 349
           A++ K++++ ENA      +        AF++F+S   A + AQT       + L    A
Sbjct: 364 AKLYKISQQIENARSFDYPTTGQ-----AFITFESMATAQIVAQTHIDSKSLMGLHIELA 418

Query: 350 PEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLK 409
           P   DI W N  I       +   + +  F +I  + +P+  +    N++ I+++ P L 
Sbjct: 419 PAANDIQWHNTYIGRWHKFFQGWFITLVTFMIILLWTVPVGAIAVFINLDTIRRLWPELG 478

Query: 410 PLID 413
            +I+
Sbjct: 479 RMIE 482

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q9P1W3|TM63C_HUMAN Transmembrane protein 63C OS=Homo sapiens GN=TMEM63C PE=2 SV=1 Back     alignment and function description
>sp|Q5T3F8|TM63B_HUMAN Transmembrane protein 63B OS=Homo sapiens GN=TMEM63B PE=1 SV=1 Back     alignment and function description
>sp|Q91YT8|TM63A_MOUSE Transmembrane protein 63A OS=Mus musculus GN=Tmem63a PE=2 SV=1 Back     alignment and function description
>sp|Q5R826|TM63A_PONAB Transmembrane protein 63A OS=Pongo abelii GN=TMEM63A PE=2 SV=1 Back     alignment and function description
>sp|Q3TWI9|TM63B_MOUSE Transmembrane protein 63B OS=Mus musculus GN=Tmem63b PE=1 SV=1 Back     alignment and function description
>sp|O94886|TM63A_HUMAN Transmembrane protein 63A OS=Homo sapiens GN=TMEM63A PE=2 SV=3 Back     alignment and function description
>sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=4 SV=1 Back     alignment and function description
>sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 Back     alignment and function description
>sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
296086714 766 unnamed protein product [Vitis vinifera] 1.0 0.540 0.731 0.0
225436954 756 PREDICTED: phosphate metabolism protein 1.0 0.547 0.751 0.0
449436814 756 PREDICTED: uncharacterized membrane prot 0.995 0.544 0.729 0.0
449515053 755 PREDICTED: uncharacterized membrane prot 0.995 0.545 0.729 0.0
255584712 756 conserved hypothetical protein [Ricinus 1.0 0.547 0.759 0.0
357133790 767 PREDICTED: uncharacterized membrane prot 0.997 0.538 0.690 1e-178
115437280 768 Os01g0534900 [Oryza sativa Japonica Grou 0.997 0.537 0.689 1e-177
115463715 767 Os05g0393800 [Oryza sativa Japonica Grou 0.997 0.538 0.690 1e-177
125552229 783 hypothetical protein OsI_19855 [Oryza sa 0.997 0.527 0.690 1e-177
326487774 767 predicted protein [Hordeum vulgare subsp 0.997 0.538 0.688 1e-176
>gi|296086714|emb|CBI32349.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/425 (73%), Positives = 363/425 (85%), Gaps = 11/425 (2%)

Query: 1   MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK 60
           MA L+DI V+A IN+LSA AFLV FAILR+QP NDRVYFPKWY KG+R SP  SG F +K
Sbjct: 1   MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFVSK 60

Query: 61  FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVL 120
           FVNLD RTYLRFLNWMP ALKMPE EL+DHAGLDS  ++RIYLLGLKIFVPLA+LAF VL
Sbjct: 61  FVNLDCRTYLRFLNWMPVALKMPEPELIDHAGLDSAVFIRIYLLGLKIFVPLAVLAFAVL 120

Query: 121 VPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKM 180
           VP+NWTGK+L++  +++FSDIDKLSISN+P GS R +AH +M YVF+ W  YVL  EYK+
Sbjct: 121 VPVNWTGKSLQNIKDLTFSDIDKLSISNVPTGSNRFWAHIVMQYVFSFWTCYVLYKEYKI 180

Query: 181 IADMRLRFLASQNRRPDQFT----------VLVRNIPPDPDESVSEHVQHFFCVNHPDHY 230
           IA MRL F+AS+NRRPDQFT          V+VRN+PPDPDESVSEH++HFFCVNHPD+Y
Sbjct: 181 IATMRLHFIASENRRPDQFTLVGPILTRRQVIVRNVPPDPDESVSEHIEHFFCVNHPDYY 240

Query: 231 LTHQVVYNANKLAQLVENKKSLRNWLTYYKNTYERT-SKKPTTKTGFWGLWGTRVDAIDY 289
           LTH+VVYNANKLA+LVE KKSL+NWLTYY+N YER   KKPTTKTGF GLWGT VDA+D+
Sbjct: 241 LTHRVVYNANKLAKLVEEKKSLQNWLTYYQNKYERNPEKKPTTKTGFCGLWGTNVDAVDH 300

Query: 290 YTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWA 349
           Y A++ KL E    ERE+VI+D  +I+PAAFVSFK+RWGAAVCAQTQQSRNPTIWLT WA
Sbjct: 301 YAAKMEKLCEAVTEERERVITDPKAIMPAAFVSFKTRWGAAVCAQTQQSRNPTIWLTEWA 360

Query: 350 PEPRDIFWDNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLK 409
           PEPRDI+WDNL+IPYVELTIRRLLMAV++F L FFFMIPIAFVQS+ANI+GI+KVLPFLK
Sbjct: 361 PEPRDIYWDNLAIPYVELTIRRLLMAVAVFFLTFFFMIPIAFVQSIANIDGIEKVLPFLK 420

Query: 410 PLIDL 414
            L+++
Sbjct: 421 SLMEM 425

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225436954|ref|XP_002271834.1| PREDICTED: phosphate metabolism protein 7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436814|ref|XP_004136187.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515053|ref|XP_004164564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255584712|ref|XP_002533077.1| conserved hypothetical protein [Ricinus communis] gi|223527141|gb|EEF29316.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357133790|ref|XP_003568506.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115437280|ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group] gi|57899278|dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group] gi|113532787|dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group] gi|215737239|dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group] gi|218188395|gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group] gi|222618611|gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115463715|ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group] gi|51038092|gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group] gi|113579008|dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group] gi|215697247|dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125552229|gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group] gi|222631492|gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|326487774|dbj|BAK05559.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2140210 785 AT4G02900 [Arabidopsis thalian 1.0 0.527 0.698 8.7e-166
TAIR|locus:2089850 756 AT3G21620 "AT3G21620" [Arabido 1.0 0.547 0.689 5.1e-161
TAIR|locus:2120673 771 AT4G22120 [Arabidopsis thalian 0.997 0.535 0.673 3.8e-156
TAIR|locus:2008860 771 AT1G11960 "AT1G11960" [Arabido 0.997 0.535 0.675 5.8e-153
TAIR|locus:2134882 772 AT4G04340 [Arabidopsis thalian 0.997 0.534 0.660 1.1e-151
TAIR|locus:2027119 769 AT1G62320 "AT1G62320" [Arabido 0.992 0.534 0.654 6e-151
TAIR|locus:2130130 761 AT4G15430 "AT4G15430" [Arabido 1.0 0.544 0.635 8.4e-145
TAIR|locus:2031735 806 AT1G32090 "AT1G32090" [Arabido 1.0 0.513 0.580 1.3e-132
TAIR|locus:2102117 703 HYP1 "hypothetical protein 1" 0.944 0.556 0.325 2.7e-59
TAIR|locus:2007126 711 AT1G69450 [Arabidopsis thalian 0.801 0.466 0.327 2.1e-46
TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1613 (572.9 bits), Expect = 8.7e-166, P = 8.7e-166
 Identities = 290/415 (69%), Positives = 356/415 (85%)

Query:     1 MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK 60
             MA+++DIG+SAAINLLSAFAFL  FA+LR+QPVNDRVYFPKWY KG+R SPT S     +
Sbjct:     1 MASVQDIGLSAAINLLSAFAFLFAFAMLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMTR 60

Query:    61 FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVL 120
             FVNLD  TY++FLNWMP AL+MPE EL++HAGLDS  Y+RIYLLGLK+FVP+ +LAF VL
Sbjct:    61 FVNLDWTTYVKFLNWMPAALQMPEPELIEHAGLDSAVYIRIYLLGLKMFVPITLLAFGVL 120

Query:   121 VPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNEYKM 180
             VP+NWTG+TLE+  +++FS++DKLSISN+P GS R +AH  M+YV T W  Y+L  EYK 
Sbjct:   121 VPVNWTGETLENIDDLTFSNVDKLSISNVPPGSPRFWAHITMTYVITFWTCYILYMEYKA 180

Query:   181 IADMRLRFLASQNRRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTHQVVYNAN 240
             +A+MRLR LA+++RRPDQ TVLVRN+PPDPDESV+EHV+HFFCVNHPDHYL HQVVYNAN
Sbjct:   181 VANMRLRHLAAESRRPDQLTVLVRNVPPDPDESVNEHVEHFFCVNHPDHYLCHQVVYNAN 240

Query:   241 KLAQLVENKKSLRNWLTYYKNTYERT-SKKPTTKTGFWGLWGTRVDAIDYYTAEINKLTE 299
              LA+LV  +K+++NWLTYY+N +ER  S +PTTKTG+ G WGT VDAID+YT++++ L E
Sbjct:   241 DLAKLVAQRKAMQNWLTYYENKFERKPSSRPTTKTGYGGFWGTTVDAIDFYTSKMDILAE 300

Query:   300 EENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWLTNWAPEPRDIFWDN 359
             +E  EREK+++D  +I+PAAFVSF+SRWG AVCAQTQQ  NPTIWLT WAPEPRD+FWDN
Sbjct:   301 QEAVEREKIMNDPKAIMPAAFVSFRSRWGTAVCAQTQQCHNPTIWLTEWAPEPRDVFWDN 360

Query:   360 LSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLIDL 414
             L+IPYVEL+IRRLL  V+LF LIF FMIPIAFVQSLAN+EGIQKVLPFLKP+I++
Sbjct:   361 LAIPYVELSIRRLLTTVALFFLIFCFMIPIAFVQSLANLEGIQKVLPFLKPVIEM 415
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IEA
TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007126 AT1G69450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
pfam13967151 pfam13967, RSN1_TM, Late exocytosis, associated wi 1e-45
COG5594 827 COG5594, COG5594, Uncharacterized integral membran 4e-39
pfam02714 325 pfam02714, DUF221, Domain of unknown function DUF2 3e-34
>gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport Back     alignment and domain information 
 Score =  154 bits (391), Expect = 1e-45
 Identities = 58/172 (33%), Positives = 90/172 (52%), Gaps = 21/172 (12%)

Query: 6   DIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLD 65
               S  INL+ A  F ++F+ILR +  N RVY P+ Y  G     T             
Sbjct: 1   AFLTSLVINLVLALVFFLLFSILRPK--NKRVYAPRTYLAGPEEERT------------P 46

Query: 66  LRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINW 125
                    W+P  LK+ + E++ HAGLD+  +LR   +G+KIF+   ++ + +L+P+N 
Sbjct: 47  PPPPRGLFGWIPPLLKISDEEILQHAGLDAYVFLRFLKMGIKIFLVGCVIGWPILLPVNA 106

Query: 126 TGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIMSYVFTLWAFYVLRNE 177
           TG           + +DKLSISN+  GS RL+AH +++Y+FT +  Y+L  E
Sbjct: 107 TG-------GNGETGLDKLSISNVVEGSNRLWAHVVVAYIFTGFVCYLLYRE 151

This family represents the first three transmembrane regions of 11-TM proteins involved in vesicle transport. In S. cerevisiae these proteins are members of the yeast facilitator superfamily and are integral membrane proteins localised to the cell periphery, in particular to the bud-neck region. The distribution is consistent with a role in late exocytosis which is in agreement with the proteins' ability to substitute for the function of Sro7p, required for the sorting of the protein Enap1 into Golgi-derived vesicles destined for the cell surface. Length = 151
>gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|190398 pfam02714, DUF221, Domain of unknown function DUF221 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
COG5594 827 Uncharacterized integral membrane protein [Functio 100.0
KOG1134 728 consensus Uncharacterized conserved protein [Gener 100.0
PF13967157 RSN1_TM: Late exocytosis, associated with Golgi tr 100.0
PF02714 325 DUF221: Domain of unknown function DUF221; InterPr 99.82
PF1470385 DUF4463: Domain of unknown function (DUF4463) 99.19
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 96.6
PLN03120260 nucleic acid binding protein; Provisional 95.35
PLN03121243 nucleic acid binding protein; Provisional 95.29
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.11
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 95.07
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 95.02
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 94.8
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 94.77
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 93.47
KOG0122270 consensus Translation initiation factor 3, subunit 92.96
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 92.77
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 91.67
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 91.24
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 90.92
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 90.24
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 88.23
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 87.58
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 85.56
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 85.33
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 85.32
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 82.16
smart0036170 RRM_1 RNA recognition motif. 81.87
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 81.13
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 80.15
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 80.1
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 80.08
>COG5594 Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-72  Score=567.63  Aligned_cols=391  Identities=27%  Similarity=0.462  Sum_probs=343.6

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCceecceeeecCCCCCCCCCCcccccccccccccccccccchhhhcCC
Q 015063            3 NLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANKFVNLDLRTYLRFLNWMPDALKM   82 (414)
Q Consensus         3 ~~~~~~t~l~~~~~~~~~~l~~F~~lR~~~~~~~iY~pr~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~Wi~~~~~~   82 (414)
                      +.++++|++++++.++++++++|++||+|  ++++|+||+..++.+  .           .+|+..++|+|||+.+++++
T Consensus        20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~--~-----------~~P~~~~ss~~gWl~~L~~i   84 (827)
T COG5594          20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQN--E-----------CLPEPNPSSYWGWLEPLVKI   84 (827)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCC--c-----------ccCCCCccchHHHHHHHHhC
Confidence            57899999999999999999999999986  799999999876543  0           12223678999999999999


Q ss_pred             ChhHHHHhcCchHHHHHHHHHHhHHHHHHHHHHhhheeeeeeeeCCCcccccCcCCCCCccccccccCCCCcchHhHHHH
Q 015063           83 PESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAFVVLVPINWTGKTLEHATNVSFSDIDKLSISNIPAGSKRLYAHTIM  162 (414)
Q Consensus        83 ~d~~i~~~~GlDa~~flrflr~~~~~f~~~~~~~~~iLlPin~~~~~~~~~~~~~~~~l~~~Ti~Ni~~~s~~lw~h~i~  162 (414)
                      +|+.+++.+|+|||+||||+|||+.+|+++|++++|||+|||++.+...+...-..++++++|++|+.+ ++++|+|++.
T Consensus        85 ~d~~~l~~aGlD~y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~gn~~s~s~l~~Ls~~Nv~~-~n~~~aHvf~  163 (827)
T COG5594          85 PDEFLLQYAGLDGYFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATNGNSDSESGLDKLSISNVSP-SNRLYAHVFL  163 (827)
T ss_pred             CHHHHHHHcCcchhhHHHHHHHHHHHHHHHHHHHhHEeeeeeecccccccCCccchhhhhHhhhhcccC-CCceeeeeeh
Confidence            999999999999999999999999999999999999999999887554322112458999999999986 7899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC---------CCCCceEEEEecCCCCCCCchHHHHHHHhhhcCCCceeEE
Q 015063          163 SYVFTLWAFYVLRNEYKMIADMRLRFLASQN---------RRPDQFTVLVRNIPPDPDESVSEHVQHFFCVNHPDHYLTH  233 (414)
Q Consensus       163 ~~l~~~~~~~~l~~e~~~~~~~R~~~l~~~~---------~~~~~~Tvlv~~IP~~~~~~~~~~l~~~f~~~~p~~v~~v  233 (414)
                      .|++.++++|.+++|++.|+.+||++++++.         .+.++|||++++||.+...  .+.+.++|+++..+++.+.
T Consensus       164 ~~~f~~~vlfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~--~e~L~~~~~kl~~~~i~~~  241 (827)
T COG5594         164 SWFFFGYVLFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS--DEELKELFDKLKVGEIDSD  241 (827)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC--chhHHHHHhhcCeeeeccc
Confidence            9999999999999999999999999999874         2448899999999997432  1458899999988888888


Q ss_pred             EEEeccchHHHHHHHHHHHHHHHHHHHh-------hh------h--------------------ccCCCCccccccc--c
Q 015063          234 QVVYNANKLAQLVENKKSLRNWLTYYKN-------TY------E--------------------RTSKKPTTKTGFW--G  278 (414)
Q Consensus       234 ~i~~d~~~L~~l~~~r~~~~~~le~~~~-------k~------~--------------------~~~~rp~~r~~~~--~  278 (414)
                      .+|||.+.+++++.+|++..+++|...+       |.      +                    .+++||++|.+-.  +
T Consensus       242 ~l~~~~~~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k~~~~  321 (827)
T COG5594         242 VLCRDLGTLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKKLNKG  321 (827)
T ss_pred             hhhhhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhhhhhh
Confidence            9999999999999999999999883211       11      0                    0156998887644  6


Q ss_pred             ccCCcccHHHHHHHHHHHhhHHHHHHHhhhhhccCCCCCeEEEEeCCHHHHHHHHHhhccCCCCCce-eeeCCCCCCccc
Q 015063          279 LWGTRVDAIDYYTAEINKLTEEENAEREKVISDANSIIPAAFVSFKSRWGAAVCAQTQQSRNPTIWL-TNWAPEPRDIFW  357 (414)
Q Consensus       279 ~~g~kvdai~y~~~~l~~l~~~I~~~r~~~~~~~~~~~~~aFVtF~s~~~A~~a~Q~~~~~~~~~~~-v~~AP~P~DIiW  357 (414)
                      +.||||||||||++++.+++++|++.|+......  +.++|||||+|+..||+|+|.+.++++.... ++.||+|+||+|
T Consensus       322 i~gKkVdaI~y~s~~l~~l~~~i~~~r~~~~~~t--~~~~~FItFkSq~~Aq~~aQ~~~~sr~~~~~~v~iapaPnDi~W  399 (827)
T COG5594         322 IFGKKVDAIDYYSAKLTKLDAEIENARKSLYENT--PTKSGFITFKSQASAQIAAQSQIYSRVLGKLKVEIAPAPNDIIW  399 (827)
T ss_pred             hccceecHHHHHHHHHHHHHHHHHHHHhCccccC--ccccEEEEEehhHHHHHHHHhhhhhhhhcceeeeecCCcccccc
Confidence            7899999999999999999999999999865543  5679999999999999999999999998776 999999999999


Q ss_pred             cCcCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcHhhHHhhcCCchhhhc
Q 015063          358 DNLSIPYVELTIRRLLMAVSLFALIFFFMIPIAFVQSLANIEGIQKVLPFLKPLID  413 (414)
Q Consensus       358 ~Nl~~~~~~r~~R~~~~~~~~~~liif~~iPv~~v~~l~~l~~l~~~~p~L~~~~~  413 (414)
                      +|+..++++|..+++++++++++++++|++|||+|+.++|+++|++.||||+.+++
T Consensus       400 ~Nl~ls~~~r~~k~~~~ni~~il~II~w~~pVa~v~~i~Nl~~l~~~~p~l~~il~  455 (827)
T COG5594         400 DNLRLSRKERLFKRISANILFILLIILWAFPVAFVGTISNLNTLSSLWPFLKFILK  455 (827)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHhhhhHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999865

>KOG1134 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport Back     alignment and domain information
>PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length Back     alignment and domain information
>PF14703 DUF4463: Domain of unknown function (DUF4463) Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.14
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.09
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 97.03
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 96.98
3p5t_L90 Cleavage and polyadenylation specificity factor S; 96.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 96.92
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.91
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 96.89
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 96.87
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 96.85
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 96.79
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 96.76
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 96.74
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 96.69
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 96.69
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 96.68
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 96.67
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 96.67
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.67
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.67
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 96.64
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.62
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 96.61
2cph_A107 RNA binding motif protein 19; RNA recognition moti 96.59
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 96.53
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.51
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 96.51
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.5
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.48
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 96.48
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 96.47
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 96.46
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.45
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 96.44
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 96.4
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 96.4
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 96.39
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.38
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.36
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.35
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 96.35
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.33
2div_A99 TRNA selenocysteine associated protein; structural 96.31
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.31
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.28
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.27
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 96.24
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.22
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 96.22
2cqd_A116 RNA-binding region containing protein 1; RNA recog 96.21
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 96.21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 96.18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.18
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 96.18
2la6_A99 RNA-binding protein FUS; structural genomics, nort 96.16
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 96.16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 96.12
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.1
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.1
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.1
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 96.09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 96.08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 96.05
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.03
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 96.02
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 96.02
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 96.0
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 95.98
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 95.97
1x4e_A85 RNA binding motif, single-stranded interacting pro 95.96
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 95.96
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 95.93
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 95.92
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 95.91
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 95.87
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 95.86
3n9u_C156 Cleavage and polyadenylation specificity factor S; 95.84
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 95.83
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 95.82
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 95.81
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 95.81
1x5o_A114 RNA binding motif, single-stranded interacting pro 95.77
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.76
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 95.76
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 95.75
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 95.72
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 95.69
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 95.68
2f3j_A177 RNA and export factor binding protein 2; RRM domai 95.68
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 95.68
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 95.65
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 95.64
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 95.64
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 95.63
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 95.56
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 95.52
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 95.51
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 95.5
2krb_A81 Eukaryotic translation initiation factor 3 subunit 95.49
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 95.48
2dis_A109 Unnamed protein product; structural genomics, RRM 95.47
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 95.42
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 95.3
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 95.24
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 95.23
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 95.21
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 95.21
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 95.19
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 95.17
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 95.15
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 95.14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 95.12
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 94.95
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 94.95
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 94.82
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 94.75
3q2s_C229 Cleavage and polyadenylation specificity factor S; 94.71
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 94.68
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 94.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 94.39
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 94.01
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 93.78
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 93.76
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 93.65
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 93.51
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 93.27
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 93.23
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 93.05
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 92.97
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 92.09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 92.01
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 91.45
2dit_A112 HIV TAT specific factor 1 variant; structural geno 91.43
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 91.28
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 90.84
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 90.62
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 90.59
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 90.5
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 90.49
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 90.34
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 90.11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 90.03
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 89.45
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 89.39
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 89.08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 88.99
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 88.79
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 88.27
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 88.01
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 87.85
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 87.74
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 87.58
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 87.46
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 86.86
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 86.18
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 85.99
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 85.94
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 85.48
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 85.36
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 85.24
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 85.2
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 85.12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 84.93
2dnl_A114 Cytoplasmic polyadenylation element binding protei 84.82
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 84.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 84.36
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 84.35
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 84.24
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 84.0
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 83.75
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 83.61
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 83.57
1x5p_A97 Negative elongation factor E; structure genomics, 83.2
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 83.09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 83.01
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 81.79
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 81.33
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 80.68
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 80.42
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 80.14
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=97.14  E-value=0.0053  Score=46.65  Aligned_cols=39  Identities=10%  Similarity=-0.030  Sum_probs=29.3

Q ss_pred             CCCeEEEEeCCHHHHHHHHHhhccCC--CCCceeeeCCCCC
Q 015063          315 IIPAAFVSFKSRWGAAVCAQTQQSRN--PTIWLTNWAPEPR  353 (414)
Q Consensus       315 ~~~~aFVtF~s~~~A~~a~Q~~~~~~--~~~~~v~~AP~P~  353 (414)
                      ..+.|||+|.+..+|..|.+.+....  ...+.|+.|.++.
T Consensus        46 ~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~V~~a~~~~   86 (95)
T 2dnz_A           46 SKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERL   86 (95)
T ss_dssp             CCSEEEEEESCHHHHHHHHHHHTTCCSSSSCCEEEESSCCC
T ss_pred             eeeEEEEEECCHHHHHHHHHHhCCCeeCCcEEEEEEccccc
Confidence            35899999999999999998766542  3556777765443
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.47
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.46
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.39
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 97.37
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.36
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 97.27
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.25
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.12
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.1
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.1
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.09
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.07
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 97.07
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.02
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.01
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.97
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.95
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 96.95
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.91
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.87
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 96.87
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 96.86
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 96.86
d2cpja186 Non-POU domain-containing octamer-binding protein, 96.84
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.82
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 96.77
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.77
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.75
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 96.73
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.73
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 96.68
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 96.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.66
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.65
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 96.61
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 96.59
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.54
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 96.49
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 96.48
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 96.48
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 96.44
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 96.4
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 96.36
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 96.34
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 96.31
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 96.31
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.25
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 96.17
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 96.14
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 96.1
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 95.99
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 95.9
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 95.71
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 95.59
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 95.57
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.54
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 95.2
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 95.19
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 94.45
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.42
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 93.56
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 92.3
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 91.97
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 91.54
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 90.82
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 90.72
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 89.14
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 87.93
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 87.86
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 87.14
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 86.97
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 86.5
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 85.33
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 84.79
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 84.27
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 83.32
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 83.2
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 81.55
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]

Probab=97.47  E-value=0.00024  Score=51.18  Aligned_cols=35  Identities=17%  Similarity=0.152  Sum_probs=27.2

Q ss_pred             CCeEEEEeCCHHHHHHHHHhhccCC--CCCceeeeCC
Q 015063          316 IPAAFVSFKSRWGAAVCAQTQQSRN--PTIWLTNWAP  350 (414)
Q Consensus       316 ~~~aFVtF~s~~~A~~a~Q~~~~~~--~~~~~v~~AP  350 (414)
                      .|.|||+|.+..+|..|.+.+....  ...+.|+.|.
T Consensus        44 ~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~a~   80 (82)
T d1b7fa1          44 YGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR   80 (82)
T ss_dssp             CSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred             cccceEEECCHHHHHHHHHHhCCCEECCEEEEEEEcC
Confidence            4799999999999999999876553  2345666663
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure