Citrus Sinensis ID: 015103

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---

MYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV

ccEEEECcEEEccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEECcccccEEEEccHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHHHcccccccccccccccEEccccccHHHHHHHHHHccccCEEEEcccccccccccEEEEEEHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEcccEEEEEccccccccccccccHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHHcc

MYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQ***************************FAQY**ADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sucrose nonfermenting 4-like protein	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	confident	Q944A6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YZQ, chain A
Confidence level:very confident
Coverage over the Query: 87-105,118-140,185-257,270-325,352-411
View the alignment between query and template
View the model in PyMOL

Template: 3T4N, chain C
Confidence level:very confident
Coverage over the Query: 68-175,186-260,273-412
View the alignment between query and template
View the model in PyMOL

Template: 2QR1, chain G
Confidence level:confident
Coverage over the Query: 78-411
View the alignment between query and template
View the model in PyMOL

Template: 2QLV, chain B
Confidence level:confident
Coverage over the Query: 1-35
View the alignment between query and template
View the model in PyMOL